e _vߋt&‰ vƇR 5@Ƈ ><Ĉxއ r& BL~7 eb7Ć~~FEFCzFSvh ***THIS VOLUME DOES NOT CONTAIN A HARDWARE BOOTABLE SYSTEM ***  w l  ť ť 0B p Aaw : ' UD$BA L &( U BQ Е*  & & @( f!ADVMACRO2 04JAN84143703ADVMACRO2[001,001] DECFILE11A .t:#z04JAN84143703&x. xQz04JAN84143703*+T. kz04JAN84143703U.NNz04JAN84143703).*O:z04JAN84143703D.,Oz04JAN84143703,,_.,Qz04JAN84143703.OPz04JAN84143703hh. ,vwr03JAN8416402203JAN84164014u-S&. , f[q03JAN8416402703JAN84164024,. ,()03JAN8416403303JAN84164029'1. ,EFkQ[q03JAN8416404003JAN84164035DJ. ,[q03JAN8416404603JAN84164042)I.,%&[q03JAN8416405103JAN84164048$C&h.#$t:z03JAN8416405703JAN84164054"i.Ks303JAN8416410103JAN84164100{.I n%303JAN8416410503JAN84164103 5U.M??vLD303JAN8416411103JAN84164106>3.OkQr303JAN8416411503JAN84164113.I$s f303JAN8416411803JAN84164117.M 303JAN8416412203JAN84164120 q.G#;303JAN8416412603JAN84164124n.P f303JAN8416412903JAN84164127Db.L**r303JAN8416413403JAN84164130).Kr303JAN8416413703JAN84164135).Er303JAN8416414103JAN841641391.D`r303JAN8416414403JAN841641423.H|r<9303JAN8416414703JAN841641467.N==~T`303JAN8416415403JAN84164150<=.L@303JAN8416415803JAN84164156z.P^^8303JAN8416420603JAN84164159]. I n; 9303JAN8416421003JAN84164207C.!F &303JAN8416421503JAN841642121t:#z xQz kzNNz*O:zOzQzOPz  r  f[q|r,??m@S ƧwTITISYSYOVv~̀ƧvRδtYYYYY?@~̈r|SY ALL  w ( ť ť 0B 2cAaw (@f ťZ+ťAť9%ť0ť$ ť  ť.@&fA bEAa$w v' UD$BA &( U BQ Е*  & & @( Nbf  e ee e &f& v JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECw D&& bЕ- eaePPPЕ-$w bD  &Е. ce a Е:   rBRMD - Segment '' not foundRMD - Terminal type not yet supportedRMD - Terminal/page combination not yet supportedRMD - Page does not existRMD - Terminal type not definedRMD - Allocated screen buffer too small for this device}RrqX]_QUq..M..I..P..CMDHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLHLATHLHLHLHLHLHLHLIOHLHLHLMDHLHLHLHLHLSSTHHLHLHLHLHLHLHLHLHLHLHL t   %  71  h    7  ))YY>W,TI,Y7"! إ ڥw2 Pwޥ w p wd w7jt5W0vvѥ  ) 'Cӥ,   @E 5@ &7>w8w5  0.7777 7777 w w w ww w v w d  w p  S7  > w JE & w! l"2 &"f _ ap  j3 w |37E%4%1%DE 5@ &7&pl!xsL!Xs05 @ !,s B!s 3% f `M%_3֦333363w 0[ 6 ,eBEŊlDVf&D lΊ L'&1&wLw ^,D B A, ,5eaE5 EE f & & 1     &w65  5U lƳ䴐ڳE U *5@*& E& & f&ËDef Ë )̋U 5 ߥ& *  + 23E Ew ^   Е-   0@A |PW e`fÊ    E &f &   `@ ` B   & A @    &ff |rW!l}R@l|rqP ZPPP,PP̶PPܶ`P,LPP,PPS,Z(P ,,,H <,QH LQH \QH lSQH |LPQH `Q ,3 ,m  ,M~ ̷,:!` ܷ,y"` y#` `y$` LPy% :& ,:' <`:( LS:) \M~* lM~+ |LPM~, `M~- m . m / Sm 0 ̸LPm 1 ܸ`m 2 33 34 S35 LP36 `37<ZPP7,L,_8d,\Q_;,l3_<,|c _=H,C~_>,:_?0, !!,,         ! ! !!!! ! !!!, , ,,,, , ,,,7 7 7777 7 7770:  ) *5@ -:G /<C     ( , ( ,(,(,(,(,(,(,(,(,(,(,(,0:) *5@ -:G /<C0:  ) *5@ -:G /<C     ( , ( ,(,(,(,(,(,(,(,(,(,(,(,0:  ) *5@ -:G /<C     ( , ( ,(,(,(,(,(,(,(,(,(,(,(, 0:!!!!      !      !      !      !      !!!!!!!!!!!! 0:!!!!      !      !      !      ! 0:!!!!      !      !      !      !      !!!!!!!! 0:!!!!      !      !      !      !      !!!!!!!!!!!! 0:!!!!      !      !      !      !      !!!!!!!!!!!!55 55 5#mw  7r - m  m}      S& FlEf Е:b/  > B `eFs 7 j 2UP POOL=SECPOOL=TASK=FREE=IN:OUT:PARSERRSEQD ,Lrg58mv=w`PH"P5M5D  W v  ,e v + 15@55 w!vw!vw!vw!vq1  e  eP  2ҕ ҕV ҕ ҕBҕL ҕ R  ɋ ҕ(R ʕ)  Wt ȕKR R R R R tR 5@2 h R Ew* ^  Bmӕ*ԕ- D  Bӕ*ԕ-  = C` r ^ m  zem2C!m  LemC!#R 'R mɕErɕE@ @ mȕPȕPJ%W! @ * $7zЕ:Нrm mȝZxȝPWpwFƳB ѥ ՀJ :Wpw2-z( $`=H=7 D= * 52 l b ^WW7 <  WW *ee ȿ   ȿbV 4"0m 5@^wl]j7`7^7\7$R7J7$H7@7$>76ZVzֿD*5@&@ .201e  $e       zVA 5w zB&5 lw  lw @   7Vw &5H5  ()K&]!!?5@@  5++<>5[]5U dm m HmW!w 5D5&5 :?L6505D&&  RIB 555 5n8<68= t   TRrՀ  >  RrՀ  E$  f  @r<wX rwJ7D<  Е:.  Е:    RrՀ 5Fĝe@7@:   4НН% %A  Е.Е: ȕ% RrՀ    ƾF t3PpAr xЕ:Cs {V. RMD - Illegal command - fdѥ,  NC wD7B  . f 2  D   . fP nnİ7ʥ ʥ` C wnJjJ\X&J\FZ8~4J&"JɥFɥRQwnɋɥ0ɥ3= EEWqD e l¥:%7 D  L,5@ 55   ev Uɋɥ=  ɋ@ wۇw3The following commands are available for this page:1FREEn=ddn: to change free entry 'n' (0-3) to ddn:/RATE=s to change replot rate to 's' seconds to returntUse the following keys to switch display pages:A - Active Task DisplayH - Help Display (this page)I - I/O Counts DisplayM - Memory DisplayS - System Statistics DisplayT - Task Header Display lets you enter a setup command if any setup commands are available for that display page replots the current display page or exits RMD $ Rɋ mW 2 2Rɋ mW  Rɋ mW tFƳB ѥ Հ0 Name Length TI Pri I/O Status flags .h  2Е ЕV Е ЕBЕL Е P В  ЕK ЕOЕWЕNЕ=PPPPPPP fFƳB ѥ Հ Task: Partition: Status: Own: I/O: Dpri: Pri: Spri: Len:R0 = R1 = R2 = R3 = R4 = R5 = PC = PS = SP = $DSW = Eflg = LUN File LUN File--- ---- --- ----   v $ (3THE FOLLOWING COMMANDS ARE AVAILABLE FOR THIS PAGE:-RATE=s TO CHANGE REPLOT RATE TO s SECONDS'TASK=t TO DISPLAY HEADER FOR TASK t TO RETURNILLEGAL COMMANDILLEGAL TASK NAMECOMMAND > %7 7 ۱   2Е ЕV Е ЕBЕL Е P <  HЕKz jE Z J : *7 FƳB ѥ Հ V BL DeviceNameI/O CountI/OPer SecCylindersPer I/OWordsPer SecErrorCount/limitlastavgsofthard#(26>HPV^dppppppuuuuuuLyyyyyy~~~~~~   "  R v  ,e   v 3 95@5 5 w!w!w!w!w!w!q1  e  eC C C v    >ȕ:e 7 `7 ^7 \7 ZFƳB ѥ Հf V BL Total tasks run:Total logons:Shuffler runs:Error sequence:Current tasks:Current users:System pool:Secondary pool:Memory utilization:Checkpoint utilization:ItemTotalLastAvg/SecDirectivesQIOsCPU ticksZero CPU intervalsCheckpointsĠĦ-Ī;ĮJIJZĶiĺxľ¾ƾʾξоҾԾ־޾   "   R 7 7 7 7 A@P FƳB ѥ Հ 2:BZJ6ؾ*.&F>.ZR5?Ȓ0;/&/   /7 Ɛ *N   NbV 4"0m 5@Ґw 47w7 7 ~ p7nlwj    AmB DmC E܁ |$ `A  wb`T܁ L `A  w $ ~ z~z=   n RrՀ    bfRrՀ D6 1  D . BRrՀ  vBRrՀ e 5  j  Е.Е:X  nЕ.Е:F \ȕ.RrՀ  =5@@9 pd7r&   Е.Е: Е.Е: ȕ%"RrՀ  + Bd <C  ȕ%RrՀ  7 J ЕNЕ/ЕAd(& C  ȕ%ZRrՀ  w Fn* T (RrՀ  n.  RrՀ  n&  RrՀ  nF  RrՀ  n>¿ | pRrՀ  :r* F RrՀ  r.  RrՀ  r&  RrՀ  rF  RrՀ  r>ƿ n dRrՀ zvrn^Zrn^Z7 C B &fā N.d C    J Е Е0Е.Е0Е0f' &' &@Е Е     0 "  Е Е Е Е  &   B A @  E A     d $ ( COMMAND > RMD - Illegal command - fdѥ,  NC wD7B  . f 2  D   . fP nnİ7ʥ ʥ` C wp:njJ\XnJFJ84&"JɥRwɋɥ=  ɋ@ w܇w^1The following command is available for this page:/RATE=s to change replot rate to 's' seconds to returnROffline Dismounted ޑf֑^v<?@A0+|z|zxvhfa_J'&%$ e*e 1 (1 (݁ : `A 0 w= N   .RrՀ    RrՀ  <ȾX& e zByy*AB ȕ. RrՀ / 0RrՀ  ;RrՀ  FRrՀ  (uu u uu u"ܸ ܺԾ@ (.& e z'y#y&fDee :$RrՀ FRrՀ @ (.& e z'y#y&fDe e  "RrՀ  FRrՀ V (D& e z=y9y5B Ab `A X w&fDee $RrՀ FRrՀ @ (.& e z'y#y&fDe e | "RrՀ  FRrՀ U (C& e z<y8y4z5@,ABB Aw&fDee  "RrՀ  FRrՀ U (C& e z<y8y4z5@,ABB Aw&fDee  "RrՀ  FRrՀ 4Y& e zCy?y;z53/ ~u%$*p k  A%  Е/ A$   RrՀ  FRrՀ @Y& e zCy?y;z53/ u'&*   A'  Е/ A&   RrՀ  FRrՀ & ey(ee* wqqq qqqe* ֎֊ևC B &fā N.d C )   Е Е0Е.Е0Е0f' n&' d&@Е Е     0 "  Е Е Е Е  & l  B A @  E A     d $ ( COMMAND > RMD - Illegal command - fdѥ,  NC wD7B  . f 2  D   . fP nnİ7ʥ ʥ` C wnPjJ\X,JbFd84J&"JɥDɥRTwnɋɥ1ɥ6= EED e p¥:%7 H  P,5@5  $ fWqev UWq*5 ȿɋɥ=  ɋ@ wۇw3The following commands are available for this page:5DEVICEn=ddn: to change device entry 'n' (1-6) to ddn:/RATE=s to change replot rate to 's' seconds to returnżv˾vv¾.ƾʲȾʲʾʲ̾ʲξʲоʲҾʲԾʲ־ʲؾ.ھʲܾʲTask not in systemTask inactive or out of memoryNo task specifiedNone  6d jt 5 &5 v7   7(Q Ջ 0`U:% $% &&A l<j.wf.&^. <%Ce>E    Y'TV=  ,  p  RrՀ     d hRrՀ  B z< r DRrՀ d 5 " J | P( RrՀ      w   ( RrՀ  A%w A j \RrՀ  Fe(  A AE* A & RrՀ -  ] P( RrՀ    =   . ,C6޾N wZ    Е.  łRrՀ         & RrՀ   RrՀ   RrՀ   ޾ RrՀ # RrՀ    RrՀ   RrՀ   7(7&C  RrՀ   77A HЕ0Е0  xRrՀ      A Е.  RrՀ  ArE` A  RrՀ    A nЕ.  RrՀ  ArE`   A $Е.  RrՀ ww~7|?w p  \ wJHD-   Ő # RrՀ -EXERDNMSGCIPRUNBLKCKRASTDST-CHKREXSEFTIOAFFHLTABOSTPASTPSPNASPNWFRAWFRACP-PMDREMPRVMCRSLVCLIRSTNSDCALROVNETMPCCMD& Е   Directive error: FID = SY  w AA,5@ ΂53 Y/'TV%)%e A5Cl2A&5Cl .*&7 7 7 ]]w U0,5]].    Е.  Е; !͐0 Е.͐(V Е,J Е)*   d $ ( COMMAND > RMD - Illegal command - fdѥ,  NC wD7B  . f 2  D   . fP nnİ7ʥ ʥ` C wnjJ\XJFJ84&"J(JɥRɥTɋɥ=  ɋ@ r‹wZ܇ɋɥ=  ɋ@ w vwܡ3The following commands are available for this page:/RATE=s to change replot rate to 's' seconds)TASK=t to display header for task 't' to return   bR -0 -7)&  @lW!j* * l= 4 |l  |RrՀ   |r |RrՀ  !%Ƴ %F ԥ  Հ|A A |RrՀ |   AS  Е0Е0|RrՀ |PP   A |RrՀ |   A vЕ.|RrՀ |   A 8Е.|RrՀ  | A AE* A &|RrՀ w8-EXE RDN MSG CIP RUN BLK CKR AST DST -CHK REX SEF TIO AFF HLT ABO STPA STP SPNA SPN WFRA WFR ACP -PMD REM PRV MCR SLV CLI RST NSD CAL ROV NET MPC CMD &     d $ ( COMMAND > RMD - Illegal command - fdѥ,  NC wD7B  . f 2  D   . fP nnİ7ʥ ʥ` C wn jJ\XJF8>4R&d"JJɥR ɥPɥT(ɥOMɋɥ=  ɋ@ R‹w:܇ɋɥ=  ɋ@ .‹)w܇ɋ$ɥ=  ɋ@ B w .ȋ wTH84߇wɋѥ=De ¥:=7 F %TI :7zۇ nۇ n h \ X T%TIB  V@ ͕:ALL7 AL L  ۇ3The following commands are available for this page:/RATE=s to change replot rate to 's' seconds6PRI=p to change maximum priority displayed to 'p'=OWN=ddn: to change owning terminal to ddn: ("ALL" to reset))TASK=t to display header for task 't' to returnć f|,JxS  &[q$S ̢SYSYTISYOV<0̢RYYYYYxw*0<| f0 p< %NPMD -- File open error %D. on file %X%N%NPMD -- Task image I/O error %2R%N%NPMD -- I/O error %D. on file %X%N%NPMD -- Bad address %P%N%N SNAP TERMINATED - REQUESTING TASK ABORTED%N%F%25SPOST-MORTEM DUMP%3N%F%25SSNAPSHOT DUMP ID: %D%3NTASK: %2R%37STIME: %Y %2Z%N z lVl# j ww JPH RR= h5 B F 5  B 5 J 5 . 50 & l l nE  +D& ^55@ @ ށĝ bveA   W P@ w PRJ!P*,75@ F 6FP  p w&0P lp P w`7&E7 b7 ^ PmP0H1 1   2  ( ʥA&5 JEweB w7  @5l l 08\fO6\$  \5ڰl<&l Eevp q& $0  %w F&f>@ tS@l   m@ 7hwf&fB  EtCe @7 E`7eB 7 t $ B&57 ` 7T7lPw JZMZ1>?SY̫ f& DZlE JЕ:'&1 | tp lڱ d \ Tڱ0 Lڱ Dt <( 4 ," $"n " "5ew , Bv    5Bw 5  (5(UW       wE5 E  W ͇5  ,E ȱ&w`E U &W )& #  4 &9U3uE uU.5`.U & E& & f&ËDef Ë )̋E U&ff  &[q &[qڱȱ &r ȱ[q}6 ȱڱE`WJ` f `8 " fy:`l Ui ) > ~7 f~5 5@ 5@w:NtSE* *Ne 5@ hDwA ܀~5@pA .g@ e"  `@ ކ·755@U &7UHN40 8Nw]z¢  5`j@w7 7 w!rw"n5wN` ZD&e F @7l b0 : ,M3M@Mq$>nA ~A vn / .$Ћ~W nѕXW tѕ n w6 xw07 .&D&5 ~3 w@. C5Cm<?&& rb&pR~ e>R~ V 7 |w<~  p > 05A<E Wtp`R~7 &w<( e> N  w@jmj`R~^50PB7 @v%NPC: %P%10S%VR%2NREGS:%5SR0 - %P%3SR1 - %P%3SR2 - %P%3SR3 - %P%2N%10SR4 - %P%3SR5 - %P%3SSP - %P%3SPS - %P%2NTASK STATUS: PRIORITY: DEFAULT - %D. RUNNING - %D.%3SI/O COUNT: %D.%3STI DEVICE - %VA%S%2NLOAD DEVICE - %VA%5SLBN: %O,%P%N%NPROCESSOR: %A%N%NEVENT FLAG MASK FOR <%D-%D> %P%N%NCURRENT UIC: [%B,%B] DSW: %D.%2N-EXERDNMSGCIPRUNBLKCKRASTDST-CHKREXSEFSIOAFFHLTABOSTPASTPSPNASPNWFRAWFRACP-PMDREMPRVMCRSLVCLIRSTNSDCALROVNETMPCCMDGFLMUTLDDPROPRVDDSPSNC| e@reC~e@lP ZRP C ̼ʼ P BN  o ~`A TA HA <A0 0Е Е  Aeu 8/eeu 8(e>Vu 8!eeu 8ĝ1Z l v eeu 8e u 8 eR6 $y  ÝÐ ~ r  r rCG fJ ͶC$ PJ r!R" 1 wP6eA0J f Е   ~&fJ J%2NEXTENDED ARITHMETIC ELEMENT%2N%5SSHIFT COUNT - %P AC - %P MQ - %P%N%2NFLOATING POINT UNIT%2N%5SSTATUS - %P%2N%5SR0 - %P %P %P %P%Ni7 e%p"AEDl 7^ L zRe~ 2%0x " TeJĺ  &eL E(: E Re~ֺ  & & @( ^Jf  e ee e d^,y``"daR``-w( "  f&@e LCn,2M`@0MJ PRP PN`E%E`A&@ C:E2 \!   C C`eP N` N`5 ʲ N` N`Е Е e 8 ew& n-Ơ/t/&,5(7 4?A$ C 5l<% Ee7?U  %2NTASK STACK%2N%5SADDRESS CONTENTS ASCII RAD50%2N%6S%P %P %2E%3S%R%N%6S%P BAD STACK ADDRESS%N  ,pn $  e  7 wl6 e N %3N%20STASK IMAGE%N%F%3N%4SPARTITION: %2R%4S%A-SPACE VIRTUAL LIMITS: %P - %P%2NID%P %P %P %P %P !%R %R %R %R!%N%7S%2B %2B %2B %2B%18S!%2E %2E %2E %2E!%N%P %2B %2B %2B %2B%5S!%2E %2E %2E %2E!%N%N*** DUPLICATE THROUGH %P ***%2N56 t l 5  # 54, 77 w7 e n17l`NXTwZETwP  : > (5  2 Fe5 B  @  e7 (%2NOVERLAY SEGMENTS LOADED AND RESIDENT LIBRARIES MAPPED%2NSTARTING RELATIVE BLOCK: %P BASE: %P LENGTH: %P%NSTARTING RELATIVE BLOCK: %P BASE: %P LENGTH: %P NAME: %2R%NSTARTING RELATIVE BLOCK: %P BASE: %P LENGTH: %P D-SPACE SEGMENT%NRESIDENT LIBRARY %2R: BASE: %P LENGTH: %P NAME: %2R%Np@,Qe we Dκ F-\ 5@ &e 7` B7 5@ " ,  ( r@,e D 5@ 5owB5@ <  Em&Re wERe R - -e Re J@5@ e ~@e r@e hre \r˻ 5e >EmRe ,Re "R mXe 5e  kQ[q [q[q|,?/?/zS  &[q$S  )TITISYSYSYCLOV0 ^(YYYYYYY?O=<0|0<F f H 'D DMP>PPJDJ- - COPzLB  kz?TLBDMP Version M07.1C (ANSI)DMP -- %X(%P,%P)[%O,%O](%M.)I/O Error Code %D.QI/O Error Code %D.?TSYBL HD IDMD FI AS`BY@BA( LBR5HXLW WDDC LI RC@SPDS2 RWHFSB8 SF > OCLC@Z\^SY&SY    -&& & Ah&?`5Ew w(HH i $%(w * 5T v  h  n P7 47 2FB7 ^7 \,.(*7 , #w w  w w   p   w &?,'fW >5W E5 W ! W 8W >W EW W W W Ō $|e <&7 7 7 6  x%1  11 1 1 11w &C ` 5 5 e   5&Е( Е, Е) eff ]    e 5 Е/ fe e @Е CЕ @ L e 5| Е Е  & Μ& Μ  e &Е[ 5ЕR5ЕW5ЕE5ЕDЕ, ]&% . d % e bfe  ,e&Е Е Е  e& & fAЕ &ɋPPЕ-PPPЕ-PPЕ PPЕ:PP& Е. є w 8& LB&a  `  W111 D K M ?   U%    vM !D  E e@P   v& SY&  `& SY& F 5 %  ~ )&B  &    * %w 5 funhj tuhdB$ 8jwaw< 8 v8w &  *AdBbAep& f  r P aAAf@pnp C*8֋ 288*Ë7AB`f Va`& WaWz  ɥ"N  ajfu-nhwFɥ;]a)wנ"å.@j  a Bw@ vŀajTI& af* v*`V @e,w jjlj ɥ@@aujk,bp @5f fˇ ȕ ‡ eSY e,5 funhwe,aja`W- f`nw^uhnw@ 8Dllja!CeH###33@# X & j8 *Vw  8jDl@ &TeBT85l@ @( D eB& # An5j)f & 2/      RՀa@'&1 $ $p X  $  | <   $, $ $ L 8 H H\ 4 $4 Z\ |l6 t lT d~\ \~H! T! L$@ D! <& 4\ , $(5ew , Bv    5Bw '(5  (5(UW       wE5 E  W ͇5  ,E (&wE U &W )& #  4 &9U3uE uU.5`.U & E& & f&ËDef Ë )̋E U&ff &f  &[q &[q &r $[q}4 E`WH\H\86ZUU\6ly\6~,\86H S!~k!~2"2"2"D8"SD$ &!( ?T$-652xmD@w :6426j9+5(   5R +B ,V P H+_ %K!,wew5~,Z )wo+, ` ^)w45OF6 U.*8% -wF- Е Е Е ep )w,7 -w|  J$-r&-2  eT,r xp |weD eBP HH(rj 7^ Nw U@ # 5"505@5]*))5  B5| *bEUX5RUR-P$& )Hw!W6f5 w5@-@ - wD F w5   w5~  w5z%e5@*]*X 5+2*BwUE= B P$& J[5@ 0-7 7 !# &E     e p 0  B $& # % l jU2S)^*n)H9):ww*&  wv*w*聇***+)w****** h( & & @( df  e ee e Get Command Line - I/O ErrorGet Command Line - Bad @ File NameGet Command Line - Max @ File Depth ExceededGet Command Line - Failed to Open @ FileX  n0 b j f n . ( Bw @`` ` ` ,"(%&  m  f A N  %-f 5 2. 4(&,]`5@S jU75Z  ro+e%'7 , 7 e~ 0  R[  w  wZ< j 7 $o+ e w 2,5_, r+(  fe57 5 % - zem5n- Lz*  w L-FFw***8w)0w|* & 5 Kw# " -6 - eEm E~e-5e)|w-JDZ j " P! H!7 d (  - ee%(Е Е   Re X7 7 5055@1s+5p +  5 V+  TE< : w6w  t 0+ . @ p  5 E`E߷ twE5  H B >Е Е E e@Е^5@p` Е%Е P e0Pl$+5./5"78߀c 1 & 555  p  r%"  hEނw- E  0W 7e`w >w X \ ` d7wPh  )P: " # " #HEADER AREA%N H.IDOF %B%N H.MPOF %B%N H.FNUM,%N H.FSEQ (%O,%O)%N H.FLEV %O%N H.FOWN [%B,%B]%N H.FPRO [%VA]%N H.UCHA %B = %VA%N H.SCHA %B = %VA%N UC.CON! UC.DLK SC.MDL! SC.BAD "JeJeRRRJe Je "e 2D 5ЕR5ЕW5ЕE5ЕDЕ, J `re 2 "@ e "er e 2 "@ e "e H.UFAT%N F.RTYP %B = %5A%N F.RATT %B = %VA%VA%VA%N F.RSIZ %O = %D.%N F.HIBK H:%O L:%P = %T.%N F.EFBK H:%O L:%P = %T.%N F.FFBY %O = %D.%N (REST)%N %P %P %P %P %P %P %P %P%N %P%NUNDEFR.FIXR.VARR.SEQ FD.FTN! FD.CR ! FD.BLK "@e e"" ""2e 2 "2 " 2 "U ` U` R"@e e e   "Bee IDENTIFICATION AREA%N I.FNAM,%N I.FTYP,%N I.FVER %3R.%R;%O%N I.RVNO %O%N I.RVDT %2A-%3A-%2A%N I.RVTI %2A:%2A:%2A%N I.CRDT %2A-%3A-%2A%N I.CRTI %2A:%2A:%2A%N I.EXDT %2A-%3A-%2A%N" D Da  g" ze eeeeeeeee e"e$e&e(e+: VMAP AREA%N M.ESQN %B%N M.ERVN %B%N M.EFNU,%N M.EFSQ (%O,%O)%N M.CTSZ %B%N M.LBSZ %B%N M.USE %B = %D.%N M.MAX %B = %D.%N M.RTRV%N SIZE LBN%N %D. H:%B L:%P = %T.%NCHECKSUM%N H.CKSM %P%N** INVALID CHECKSUM - SHOULD BE %P%N" D Daz peeeeT pw" e2 22e 2 2  D$E e e "  222 2 2 e "J  @d u J" @^A` & & @( tf  e ee e (SY%X%N%VA%VA%N%VA%VA%N%VA %N%VA%VA%N%VA%VA%N%VA:%VA%VA%VA %N%VA%VA%N%VA%VA%N%2A%O:%VA%I%VA %N%VA%VA%N%VA%VA%N%2A%O:%VA%VA%VA Command syntax error%N%VA%VA%VA%I\%T%s%k%%%%% 6 5  5*+5U5 5   BBCU% B   vn $5 %H@8 $7    <%UfUh<%&& <% ^Е ȕ-ȕ  $  :   $B$N%Qe~5)E$ %& e eTUUO% & N%"e e\^$% 5R  Q%eH $ -- $$ N%$ A% & & & & f& & & Ν )  % BUN%$ 2$% LB$%eD eD%P Е; &  m  f A N  %Failure from FINIT$, not enough stackCommand syntax error Open failure on input fileOpen failure on output fileCannot find input fileIllegal switchNo lists or wild cards allowedI/O error on input fileI/O error on output fileFailed to read attributesBad device nameFailed to assign LUNNo input file specifiedBlock switch required in logical block modeIllegal use of /RC switch Illegal density valueIllegal value on /HD switchFailed to attach device *** EOF *** *** EOT *** *** EOV *** *** WARNING *** *** FATAL ******** This block has bad parity ***** Dump of %2A%O:Dump of %2A%O:%VA%X - File ID %O,%O,%O %N%P %P %P %P %P %P %P %P %P%N%P %N%P %R %R %R %R %R %R %R %R%N%D. %U. %U. %U. %U. %U. %U. %U. %U.Dump of %2A%O:%VA%VA%VA;%O - Rel. Filnum %ODump of %2A%O:%VA%X - Rel. Filnum %O%VA Virtual block %O,%P - Size %D. bytes%N%N%VA Logical block %O,%P - Size %D. bytes%N%N%N Starting block number = %O,%P%VA%N%VA Record number %D%D. - Size %D. bytes%N%N%VA File header%N%NFATAL - Page header line too long|hQ,11OS S  &[q$S PÄ 6TITISYSYTICLWKOVSϳP*fhh YYYYYYYYRLK\ϳShQ|ϳf& hhT^ .N 7n  MAC>  n  MAC>   r -ڞ 8- ۶<7 2.Wednesday dd-mmm-yy hh:mmH gh 64 &[q &[q &r [q}z E`W0kQr  kQ:' S'Ls:jLkQxs& 5 g,x-B &,x-t0TK H!/x-t0fFwjL2x-0B< z||kQSYMAC -- Errors detected: kQ gOqzw"" @PAMLENDS VP T X \ ` d h l p t x |         NSY^SYLINLSP@kCR EN:DS d         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |         ? :'='@'B'D'@H'L' P'T'X'\' =% R G @X l@ .w4ffw w@ 0 BrwkQ5"S L.qfi ,.g%NL\`W N &"5@].5U@e 5# 7\7^T&7 HX&&0#ZV# z,.  0 $0 &. N # FÇ B feB& &Ájf0 XeR D# LA  F# 8-# *wkQ f=1 5  ^ l d‡,.w2 ԩ7 &z 7p"&2(w)PeHqqaaa# ABCwW!7 0L.w` *0 @ 5w.T beB Ʒ  b d 8 `.".. " wX V7 Zl0f0h -  w4f  7  "R& ؁e z7  X7 "4&1 p l7 |W  TN@ eB Ŀ1  r  ] %7 5!eH 7eH R 0 PN" ,.   8  ^&   w&  | & ֦ h & ¦ T& e <& p& H E: TA & fA & X .& L&- '- - '  )'  r  ` BfEhBa @ J  ܥ n  @ ?J"eBĔ`fe5@Pʝ x p %7 7e 5@f ҽ w<  x A \   7 dH gwRѕ a E^UX 5   Ȧ7  7 , 5@E~Ux d 7$ UPb w ڮ  ,  45b7 J5 J`' ʣ7 7 >7 4 Ҹ Ĺ3 b   de X 5Ӥ2d     w 7pp-dFx  f5 ֭m' ̢ gɥa ȭҕ m,. %e  e e tz j ~ҕ h Fҕ e Nҕ ҕ( 74N  ҕ,) ezt n l  F 4 b w  @&  `e# 3mf Ce&&&& w  ~#- Cew  >wm:w& |w z ( J  & T!JO  j w< ȶ7B@*e'  >D$ m 7bTTTTf TTTT  Ne @  8ew   Z D awwTw >  0@ 7"F B & #<N ڭY@@ޖޒ      b 7535@ n  5  5 r Ff 2H 2  F # j"ҕ  ̊ҋ5"@ы& "R &m   e e HlbRR  Zwf&&7  X#-%! e  &b@ ( @ !f  e ee e w 8w`       7 7 7   W,@ ı7 7|v  #     0 4> 07 0 t 7  `wXSY0:MACTMP*** Assembler statisticsWork file reads: Work file writes: Size of work file: Words ( Pages)Size of core pool: Operating system: RSX-11M/PLUS (Under VAX/VMS) (Under RSTS/E) (Under P/OS) Elapsed time: RORWDIGBLLCLRELABSOVRCONSAVSymbol table****** ' B0 B0 B1 B`1 B 1 f-w 5 funhj tuhdB$ 8jwaw< 8 v8w &  *AdBbAep& f  γ P aAAf@pnp C*8֋ 88*Ë7AB`f Va`& WaWz  ɥ"N  ajfu-nhwFɥ;]a)wנ"å.@j  a Bw@ ŀajTI& af* v*`V @e,w <jjlj ɥ@@aujk,bp 5f fˇ ȕ ‡ eSY e,5 funhwe,aja`W- f`nw^uhnw@ ܰDllja!CeH###33@# & 8 *r)F)w  8jDl@ :TeBT85l@ <@( D eB& T# PAn5j)f & 2/      RՀa@!'8(kQSY kQ @W! )j÷'  :  j'  w nUeBUUUUU݇ "S` 0)beB Ҩ' r ȕ p8'eB$& 0# , wBBU W!<& h  @B!  w! -- .INCLUDE directive file error! -- .LIBRARY directive file error  n !r+|,.|8 KK} NW&XHXs[sr֯֯zdzxd  ձ gskQxLB[1,1] qD~~~Z(@v(#(-((BIrW(,xKKMQ3fJOq` %K[MQQR Rwyz[-7  7 7  @-%?S ! >RZ%= n XH Bx=C Ļ U  C 7  f7w&X7 PdY  \S  %\v 4 %%=, 'ŝ   @ H , %,   S |   J  7  Ý1.    HE tE  5BU n7 f n 8 ؼ W ϊ we/uf ԕ$ &7 7# .f e0T7 R :  TD >t9 Ĺ ` v X U  -֯ ( Ⱥ ¸  B : :  " W!'    ԻşE f' 7  $ "7` ^ @7   w   -- T@.* Nb pRRRRR D7 W . xA w  7  ^  eBb B   \ # X   hW!$ (W!=W!: W!: ׯ.   4U@ &   7 Z7    @ R ~ :X57 ! @  C * 7w f | U & 7`w` & f J  0> x    V Ը $ 7  V J 4 Df  * ~    $e 4~*U wr   wNwBCb d!hL  P &  з7 ^ tVC  2Rj0.  %A  w 2m Ҷu   5 7 7  7hwhw d . <ҝ<:7  b ^ĝ T жm Up X ^ 7 -x U\fb  Ŕ U( ڵ 5 ($ 7   ` U@U  %RR < %,  ڵ5w7 w ) p fW"* ! ! C  7   5 "7UU ƴ `  D]F IU C v n   ദ  W!$ δf  B 5@  C BW!&W!!B  C  ض 20U@ ¶X  @ F@EB  DE5b @ @ ՋC w p7 @ Ȱ  ⱇ p  L `  n ,5Ux7w@ BW!<% @B!  lE 4 dU$ & # &    (U& 6e  W      B z58EU@ P   wN 7$ & Z Ƶ^@ ( ^ ^ PUD ]w  H L bw8-* J U߇784 ҕ  JW! U ҋ şEҕ  . 4  R^ αşE [5@OL dF# ?- 4 n  pZ X 8-H ,  \p eBfff    e0J UU ~  CUއ   C!w 2  U"E   5@P˵ ŀ Հ جU* -0UN5f7 8 f 5EP W!:U@  5 EU P5-ʭ  (5 UU5U   " 8 f]I LW!:W!=R 5 Z >4 2w: W!$ NW!: & 5\   " h 8  b w  h5U  ܮ& W!=@ ̮W!: ®Ufff & H 5@jUR& # 5 5U@U5@5 @5EPE?UW" 5 ˵`7܇Uۇf r55 U5 &  7^ ۷fwEwv & f& A$fE > 'wb Ί 7P" œ-  F 0E%P%E% 5E%pE%E%% A A 5Uڇ h5UE >ڀ   UE .& \ f   z n    ҟ ȟ0U @ ̚ & ` RVH UUW#ŀ5%   @UcW!(3Հ U ] ŀ ~ W!+Հ W!+ U>5U8 PU0- x ƞW!(5( 5UU7 5UE > (ŀ PU0 $  U  W!)w U؇ tQ- ,˵ ˵@KQ˵ JыE V @W-˵\-7˵@1Q#ыʋ *ы   e f&  J $7B7@ 7 <"؀ m<  ыJ ԋ  Հ   Ɲ  ` ,7 7 zlbRR  wHf&&7  #-%! e  !  B  6P0@ Pz .׃UׇD  Н7&ه t7 7 > ʥ Sb D   tUD 5ӝ1 T d ӕ ӝl , > #d6 6 ƥ bl 5d7 6w¡e UՇ  (7 7  5,ڞ ̘  wږ  )   B  P0@ٗ0 "` PUZՇ  rU :Շ &,@@8K@BaTq rtv.MAIN.Table of contents  T- T. T|@ he~|$|(d|W*|Xj|d:|hez|D0M/|D9Mo|DM?|DM|D`Y+|DiYk|DZ-|D Zm|De;|De{|D0f,|D9fl|~d=|~he}|[M |[M(`|P|P|P|P@|P|P|P|P@|,P0|,P1|,P2|,P@3|,P4|,P5|,P6|,P@7||Q%||Q(e|S|S(X|Sp|SqY|Sx}|S}Z|Td<|The||9wW"|9wXb|x!|x(a|AyW#|AyXc| zW)| zXi| zd9| zhey|bRR ԲRR ҳW   7p& & ikQ & : w ӜҘ% &?fW @W >5W E5 W ! W 8W >W EW W W W Ō  $|,e f** aB X¥*W W c@ % $B1&  m  f A N  %11?|-A|-   -- I/O error on output file -- I/O error on input file -- Command syntax error -- Invalid filename -- Invalid switch -- Open failure on output file -- Open failure on input file -- Command I/O error -- Command file open failure! -- Indirect command syntax error -- Indirect file depth exceeded# -- Invalid format in macro library# -- I/O error on macro library file -- Insufficient dynamic memory -- I/O error on work file -- 64K storage limit exceeded?U ܢe`7n f &7   ` ;?0 sn@`e@` Ve eD b L 1 1 1 7w*/w< BD U50e7 Rz7 wHeE& & Y-&- bT*/J/e/ wZk.N1BНННP B (` Bҋ B hfwΣ-@  0  Ω ĩb % ww6 % LHԷ w x% F"8/4/. |xtww mB 7 & .0 T >@ P  8 r 7%27%.炷 (xڢ . ҭ ^& 0 L# X %   L ժՇ * /.w J" , 5   7   P  FՇ  -U2-L D  ӷ  Г2--! W x-A"%+%- $5  \ 0bab b b m %.w ށ%E  Ȥ &7`@@T@T@Th 1"3  e~ x t   5  > 8 4 e(#U b(J  5 *  U-r -  U m7 7 р7 w" 0 B $  4 $ la      b b b w Z%+%- > *0W! W  4UЇ w 5 8 L *La L ֑  梷 `7 w آ0  L : % ).......:Yw/M !/w$ ffff Z* Mm e< e< eA ҕ:A ҕ:A ҕ.A  f=. @4HD E& c `5%E m- A- ֔ҕ $  @ҕ- ce.RRRҕ- " ҕ $  ҕ:  W ҕ0wMondayTuesdayWednesdayThursdayFridaySaturdaySundayJanFebMarAprMayJunJulAugSepOctNovDecUnknown ffR\ݢzݚݢv+-0*L/&(!+-"'%< ^C2D6O:BPFXRxd@yuuuuXu0u !"#$%&'  @ @%+2@8>DK@QW]d@jpv}@@@@΀@(Px@h0X Hp8`(Px   @@@@@@@@@@@@@@@@@@@@@@@@@@LI<NL<CR8 EN(P DS(x l  wA 2   B ? w w wX EU w wdC wfC w wjC@Ul? w> %bbgfhf6  RRRRRRRRR⋇ HH &&  D ZA$ C! z˵&ԝFԝC >7 E E (E e$ > C  f  "  q> @% J>   Č JC5B(K>I@  p.>,>+>)@w- >@  j D> B@aJE = Bw 0E5B= 0ҝ=@Eċ(杬= ĝ=ĵ ҕĵ@ ^ċҝ}=ĵ ҝp=ҝm=Ίހ 7 T=   , ҝP=ҝM=ѝH= ѝA=w2B wa@=<=:?bҔҔҔҔ!?B%dD VD -A5.A A9B X<-΋25 ><% @"$5@Z<*<5@< zC5x@E<DMh@=b@;  ;; x:BV?;h %h |H H5@  6 oʕ oҕ T5@?  rҕ X5?5?  ҕ  A 8; ,h ?(; A 5?  @ ,;7 *;7$;:!ED ?ы7 :R@ 6   7:7 :&A  5 ʕ'5@ʕG5ʕC  4  `   z:   f: 7 `:7 `: U>:P: F:>:Հ6: < !& RH Z  .E5 : U9 ՀU&fffff  (    h  J$ ^ H 7 9db(55  d9̵E єJ BR&  N C@   N C   E7 85  8 8w K-8 \#5E 5U855@XU@t8E@Rlb DI> > > 5@<UPU@.8 5@|<  (l9 x 8U 8W!. W!$U7    W!. U@7  e<ş˵@ < <  b   &  ɟ7ŀ  U @ W!> w H& L c7 B7 (eeef8b8 xZ8 v 4 H   * `!@w(f   ;5%~;6 wT 2 T 08 7`887 8 87 8`6\6 *8  C   7Pl6]7w(::7=  n=  R7: P7 \w :-X8: 7@ U5 5c 777 7 = +D` W! W! W!  &7 |7RE@ 5@59e JU *5:.:5p97:05 > &7wf 5 emZ9 VW!  -<9<9w!4& @}e * w"979U4 w T  e !U@j4 @58e;7; : Z4<4@74P424<4,4@'424"4 fAʕ RfA  eʕ Jҋ : : :: lĝ97 9 Y+ 5(V>5f"8 6+ j5  5ҕ-5    " BRŀɕ?   p:  d: 7 2225 5 5  @ :w4 7"2 (74&7272 4dee & t ^ l^<8\<\ 88#5R2 N256 7 8:2-02B 02 ,U-  -7 -.-E--  -  -ş- $ --  L <* * -wl    p 8-w0 * bff  7 ++wR 0 w B U~+ LD 0 7 2v<>C!W!^ 8! 2 pC D v z2C!D! f2 UU +-`P: :7,, x H 7* 7,f   "eE  w 4&e4w  FE l4 A B` ^47X4pA \wR B24! B  @` 4 B`7 4m3e33w TE R 3 B ` p 3733A73 @ae 3 3 3  3L 0 Bl3 ` L J37F3)  ) ( & 3 &3&2( p< 4e6(@   xH 2 2z( Hp< 4e6(@   2\2 䇷 z2 r27 <2w62 22e`)w2 7 2  w tf 0T^  !& fY w`1K`5W  L  & D -N  ~1  `   CRDSEN2LIrNLMACRO V05.01b ABDEILMNOPQRTUZ Page  '&1 ,7 $7$ 70 7 7 7( 6$ 6, 6 68 6< 6~ 6 6 6H 68 6| 6& 6 6p 6t 6  |6( t6& l6` d6X \6 T6L L6( D6V( <6  46  ,6 h $6  6 , 6 4 6  6  5  5  5  5  5  5  5 r 5  5  5 # 5 # 5 " 5 " 5 P" 5 # 5 ! |5 ! t5 # l5 % d5 $ \5 n& T5 @( L5 ^* D5 * <5 B+ 45 \, ,5 + $5 + 5 , 5 + 5 , 5 , 4  4. 4 4B1 4BR0 4B/ 4B/ 4B0 4B0 4T / 4T differences found No differences found/ TI &% NSYr  V  kQSYSY 1.D 2VD V ) -- Illegal switch or switch value -- Open failure on output file -- Illegal /LI value -- Command syntax error &?,'fW >5W E5 W ! W 8W >W EW W W W Ō $|e '&1    p ,    \ 8 < d 0 | X $  L H    ( |  t $ l ,% d % \ & T %5ew X , Bv    5Bw 65  (5(UW       wE5 E  W ͇5  ,E @&wE U &W )& #  4 &9U3uE uU.5`.U & E& & f&ËDef Ë )̋E U&  m  f A N  %&ff  &[q &[q &r [q} E`W Sl qQWllw 45 funhj tuhdB$ 8jwaw< 8 v8w &  *AdBbAep& f  P aAAf@pnp C*8֋ |88*Ë7AB`f Va`& WaWz  ɥ"N  ajfu-nhwFɥ;]a)wנ"å.@j  a Bw@ xŀajTI& af* v*`V @e,w Xjjlj ɥ@@aujk,bp 5f fˇ ȕ ‡ eSY e,5 funhwe,aja`W- f`nw^uhnw@ :Dllja!CeH###33@# " & l8 *  w  8jDl@ 0TeBT85l@ @( D eB& # An5j)f & 2/      RՀa@w 7   .  A. 5f  .0D qBCr r &   r bŝ0 X&. N D < r 3  T5P. 2  2 w 5!2b( \  2  Tb( ,5IrЕ-& r  A Е, A  $Е, Е,Е/Е;Д/r@f  . 2  ww @ 61w  @ *w:@B 21 1ap1 6 5 5 W  d5p <' |P<'Dw8e`  ( n4 (. ,wr3au qss   55; 55 ve  <' W,  ( 4 (" |w ( 4 (" Tw-@) 4 >)$ w f pp z b) 4 b)  Lw&f&f ************************************************** -- Too many differences for available core -- Error reading input file #1 -- Error reading input file #2 %1A) %2A%M:%VA%X -- Open failure on input file #1 -- Open failure on input file #2 -- Error writing output file|,&&QS  &[q$S 2 %&TITISYSYTICLOV<0 R ^ZYYYYYYYo?0<|0&f& v @l* V  l' VFY>P{L}&VFY Version M0528 (ANSI)VFY -- [0,0]File ID %P,%P %X Owner [%O,%O]file ID %P,%P Summary: mult = %D. free = %D. bad = %D. Header map error I/O error reading file header - Error code %D. Bad file header %D. Lost files were found Rescan of volume to find all files with multiple allocation%NIndex indicates Bitmap indicates %N File header does not exist?TSYUPTRETFRTIDTDE0TLO@TDVTLITRCTz HDTALT xQzSY SYt:#zSYz (Xww0 p  d   Z  n8&0    5   500 D . E  5 5@ 4 a tw6   N5B- h*U4 Y &7 " V6 @ `ww  pmp!+ 05*5ww,w,-( -"5@xw5@lwBw R t &E     0 6 e p 0 mp  85E >jw\pppm  U- , wHtP \5\  Bd "  w,J4*  4w5 . ~vp z w v 8dwVU5 #5   beUT  aP 7 87 Z7 R7 Pv 8@]>]<4,*( 5 "  ` D BC % 4 '&1 <DX 4D ,DP $D D V V, VL VP V` D, V z z V D V$ V4 r D    < |x t l d \V( TV LD8 DD| < 4" ,D$ $DL D< DH ! D\5ew , Bv    5Bw ZYZ5  (5(UW       wE5 E  W ͇5  ,E 2Z&wE U &W )& #  4 &9U3uE uU.5`.U & E& & f&ËDef Ë )̋E U&f &ff  &[q &[qD2 &r 2V[q}  2DE`W 4zZI9 4lhkM4hN`4hq4hC4hzh$ ""` & & @( &f  e ee e [1,3]The following files were not in any directoryFailed to open directory fileFailed to close directory fileI/O error reading directory file They have been entered in directory %VA They are still lost, could not find directory %VA Failed to enter file - Error code %D. File successfully entered as %X Error code %D. - Directory [%I] As a result, no files will be entered in %VAThe following directory entries were invalid[%I] File ID %O,%O,%O %X - %IFile not foundInvalid version numberReserved field was non-zero %D. Invalid directory entries were found %3A,%3A%VAQ&o60#  mX ܇$  4E, ~ 6L   "p\\p^^pVBpXDpZFNN7 Z5 |5@zw$ 1 0 $p&p6 w Fp%hd [5   6 ^ w0 w@ ^ -@ &&&&eH&&& 2)TTT|TTT NeB| p *  e& 24* 4 5@ 4 U 5 (!#   `  54 RF v 5j, 8)  *1 *4y   & %  "m X -  -  D`#[j  4 " J4= v| < 6 0ȕ W0W9 D!  T e ѥ  R4* & &  m  f A N  %Failed to find INDEXF.SYS;1 in MFD - Will open index by file ID 1,1Failed to find BITMAP.SYS;1 in MFD - Will open bitmap by file ID 2,2%NConsistency check of index and bitmap on %2A%O: Listing of index on %2A%O: Read check of files on %2A%O: - Blocking factor %D. Storage control block (VBN 1 of BITMAP.SYS) is corruptedContinuing with an approximation of the size of the volumeOnly the "blocks free" value is validThe "blocks used" value is valid in the line beginning "index indicates"The "blocks free" value is valid in the line beginning "bitmap indicates" P35w7  & P5# # v* D:$wBDx b .  X H  70w. CC & e  å~ `eBC    D } 5 ( 5x 60x$& ,k7,\7,^U#  W m  J M5@n4t5 :5%e0E'f( 7w  @72 hw:&oQw1J \BVJH   f V* EB  2E7  B`wl6 P 5  : 6 fQD@ ` 5nSY7 v# (   R n7 5(5 #5"# !# * D BD4 0 R h  e7 jeB$& ! e     , Failed to open file for read check - Error code %D. Error starting at VBN %O,%P, LBN %O,%P - Error code %D. Error at VBN %O,%P, LBN %O,%P - Error code %D. File ID %P,%P %X `6x  `ˋl,,d!# C $eR # # #   p!& Ti% ~%f 0 d N   B4 L6 wBD 3 %*1p sas &ff4  *Z  `e @   !  CbB a(4  &5 H e   ~Е.Е/e jЕ.w^ L Multiple allocation %O,%P Bad block number %O,%P Block is marked free %O,%P File is marked for delete I/O error writing file header - Error code %D.. blocks free, . blocks used out of %N%2A%O: has Delete this header [Y/N/Q/G]?  5 ŀ * <0 @ @`e  w eB w X&   k p= 66 ~  w02 Z w@" \  r J  Zw050 P \5 w@   0  ,CaB h w@ n P   d mp  \ & wV |3 En E   t@w5 $ n%&  m  f A N  %&7 7 7   %1  11 1 1 11 & & @( r f  e ee e kz?TLBOPzLB  (Illegal deviceOpen failure on bit mapOpen failure on temporary fileFailed to allocate space for temp fileFailed to detach deviceFailed to attach deviceCommand syntax errorI/O error on input fileI/O error on output fileIllegal switchOpen failure on listing fileOpen failure on index fileNo dynamic memory available - Partition too smallClose failure on bit mapClose failure on index fileClose failure on temporary fileClose failure on listing fileIllegal response - try againSY%X%N%VA%VA%N%VA%VA%N%VA %N%VA%VA%N%VA%VA%N%VA:%VA%VA%VA %N%VA%VA%N%VA%VA%N%2A%O:%VA%I%VA %N%VA%VA%N%VA%VA%N%2A%O:%VA%VA%VA Command syntax error%N%VAI/O Error Code %D.QI/O Error Code %D.! !+!#!L!D!n!f! 6 5  5*+5U5 5   BBCU% B   v $5 %0( l 7   UfUh&& * Е ȕ-ȕ  H   !  HBH!Qe85)E$ %& e eUU! & !"e e\^$% 5R   !eH  --  !(j A! & & & & f(& & & Ν )  % U! 2H! BHB  8&! !  N %w @b& LB&a    W111 D K  M ?   (U%    vM !D  E e(@P   & SY&  & SY& p 5 (%   H)P &?,'fW >5W E5 W ! W 8W >W EW W W W Ō $|e є &  m  f A N  %t:zs3n%3vLD3kQr3s f33#;3 f3r3r3r3r3r<93~T`3383 ; 93! &3<0Q  @>$t:fk""@0Q GH8.;+ QIOERR -- Translate qio and fcs error code to string.; .; Input:-.; p1 = error code as an unsigned octal value .; output:9.; = the error message associated with the value.;.; Example call:.;.; @indsys/lb:qioerr '',.; ; Error code "''" is "''".;A.; Values in which the low byte is in the range 1-177 are assumed8.; to be various success codes. from 200-377, the values<.; are assumed to be FCS-11 error codes. Values in the range@.; 177777-177200 (-1 to -200 expressed as a word) are assumed to>.; be RSX-11 directive error codes. If the byte vs word coding@.; is not determinable from the input parameter, the byte coding.; will be assumed.;.; .setf i$esub% .ifenabled substitution .sett i$esub; .setf i$edec' .ifenabled decimal .sett i$edec .ENABLE SUBSTITUTIONb .disable decimal - .SETS "No message defined for 'P1'"s' .TEST P1 ! VERIFY OCTAL/DECIMAL TYPEd .IFF .SETN NUM 'P1'. ! 0 .IFT .SETN NUM 'P1' ! CONVERT TO NUMBER( .SETN HIG NUM/256. ! ISOLATE HIGH BYTE, .SETN LOW NUM-(HIG*256.) ! ISOLATE LOW BYTE+ .SETS STR "'LOW%ZO'" ! AND BACK TO STRINGa$ .SETS TRG "B" ! ASSUME BYTE ERROR1 .IF HIG > 0 .SETS TRG "W" ! ASSUME WORD ENCODINGi5 .SETS TRG TRG+STR[4:*] ! CONSTRUCT LABEL FROM VALUEsE .IF LOW > 127. .GOTO GOTERR ! THIS IS AN ERROR CONDITION(LOW IS NEG)T2 .SETS TRG "S'NUM'" ! THIS IS A SUCCESS CONDITION.GOTERR: .ONERR NOLAB ! CATCH ERRORS, .SETN 201 ! PREVENT ERROR DISPLAY .GOSUB 'TRG'U" .iff i$esub .disable substitution .ift i$edec .enable decimal .EXIT.NOLAB: 6 .SETS "Illegal message code supplied <'P1'>"" .iff i$esub .disable substitution .ift i$edec .enable decimal .EXIT.;.;&.B377: .SETS "Bad parameters" .RETURN-.B376: .SETS "Invalid function code"I .RETURN(.B375: .SETS "Device not ready" .RETURN..B374: .SETS "Parity error on device" .RETURN3.B373: .SETS "Hardware option not present"L .RETURN+.B372: .SETS "Illegal user buffer" .RETURN+.B371: .SETS "Device not attached"< .RETURN/.B370: .SETS "Device already attached"b .RETURN-.B367: .SETS "Device not attachable"X .RETURN,.B366: .SETS "End of file detected" .RETURN..B365: .SETS "End of volume detected" .RETURN6.B364: .SETS "Write attempted to locked unit" .RETURN$.B363: .SETS "Data overrun" .RETURN,.B362: .SETS "Send/receive failure" .RETURN*.B361: .SETS "Request terminated" .RETURN+.B360: .SETS "Privilege violation"< .RETURN0.B357: .SETS "Sharable resource in use" .RETURN/.B356: .SETS "Illegal overlay request" .RETURN;.B355: .SETS "Odd byte count (or virtual address)": .RETURN6.B354: .SETS "Logical block number too large" .RETURN,.B353: .SETS "Invalid UDC module #" .RETURN).B352: .SETS "UDC connect error"E .RETURN0.B351: .SETS "Caller's nodes exhausted" .RETURN#.B350: .SETS "Device full". .RETURN'.B347: .SETS "Index file full"5 .RETURN$.B346: .SETS "No such file" .RETURN5.B345: .SETS "Locked from read/write access"N .RETURN(.B344: .SETS "File header full" .RETURN*.B343: .SETS "Accessed for write" .RETURN4.B342: .SETS "File header checksum failure" .RETURN;.B341: .SETS "Attribute control list format error". .RETURN8.B340: .SETS "File processor device read error" .RETURN9.B337: .SETS "File processor device write error"  .RETURN4.B336: .SETS "File already accessed on LUN" .RETURN2.B335: .SETS "File ID, file number check" .RETURN6.B334: .SETS "File ID, sequence number check" .RETURN/.B333: .SETS "No file accessed on LUN"B .RETURN4.B332: .SETS "File was not properly closed" .RETURNA.B331: .SETS "Open - no buffer space available for file". .RETURN+.B330: .SETS "Illegal record size"U .RETURN?.B327: .SETS "File exceeds space allocated, no blocks"B .RETURNB.B326: .SETS "Illegal operation on file descriptor block" .RETURN'.B325: .SETS "Bad record type": .RETURN6.B324: .SETS "Illegal record access bits set" .RETURN:.B323: .SETS "Illegal record attributes bits set" .RETURN9.B322: .SETS "Illegal record number - too large"  .RETURN2.B321: .SETS "Internal consistancy error" .RETURN4.B320: .SETS "Rename - 2 different devices" .RETURN=.B317: .SETS "Rename - new file name already in use"S .RETURN*.B316: .SETS "Bad directory file" .RETURN4.B315: .SETS "Can't rename old file system" .RETURN,.B314: .SETS "Bad directory syntax" .RETURN).B313: .SETS "File already open"b .RETURN%.B312: .SETS "Bad file name"I .RETURN'.B311: .SETS "Bad device name": .RETURN+.B310: .SETS "Bad block on device" .RETURN<.B307: .SETS "Enter - duplicate entry in directory" .RETURN;.B306: .SETS "Not enough stack space (FCS or FCP)": .RETURN6.B305: .SETS "Fatal hardware error on device" .RETURN1.B304: .SETS "File ID was not specified"X .RETURN4.B303: .SETS "Illegal sequential operation" .RETURN,.B302: .SETS "End of tape detected" .RETURN*.B301: .SETS "Bad version number" .RETURN'.B300: .SETS "Bad file header"o .RETURN'.B277: .SETS "Device off line"t .RETURN:.B276: .SETS "Block check, CRC, or framing error" .RETURN%.B275: .SETS "Device online"B .RETURN$.B274: .SETS "No such node" .RETURN,.B273: .SETS "Path lost to partner" .RETURN*.B272: .SETS "Bad logical buffer" .RETURN5.B271: .SETS "Too many outstanding messages"e .RETURN2.B270: .SETS "No dynamic space available" .RETURN+.B267: .SETS "Connection rejected" .RETURN*.B266: .SETS "Timeout on request" .RETURN8.B265: .SETS "File expiration date not reached" .RETURN'.B264: .SETS "Bad tape format". .RETURN6.B263: .SETS "Not ANSI 'D' format byte count" .RETURN).B262: .SETS "Not a network LUN". .RETURNG.B261: .SETS "Task not linked to specified ICS/ICR interrupts"a .RETURN4.B260: .SETS "Specified task not installed" .RETURNF.B257: .SETS "Device offline when offline request was issued" .RETURN/.B256: .SETS "Invalid escape sequence": .RETURN/.B255: .SETS "Partial escape sequence"N .RETURN*.B254: .SETS "Allocation failure" .RETURN$.B253: .SETS "Unlock error" .RETURN+.B252: .SETS "Write check failure"L .RETURN*.B251: .SETS "Task not triggered" .RETURN:.B250: .SETS "Transfer rejected by receiving CPU" .RETURN4.B247: .SETS "Event flag already specified" .RETURN+.B246: .SETS "Disk quota exceeded"N .RETURN.B245: .RETURN.B244: .RETURN.B243: .RETURN.B242: .RETURN.B241: .RETURN.B240: .RETURN.B237: .RETURN.B236: .RETURN.B235: .RETURN.B234: .RETURN.B233: .RETURN.B232: .RETURN.B231: .RETURN.B230: .RETURN.B227: .RETURN.B226: .RETURN.B225: .RETURN.B224: .RETURN.B223: .RETURN.B222: .RETURN.B221: .RETURN.B220: .RETURN.B217: .RETURN.B216: .RETURN.B215: .RETURN.B214: .RETURN.B213: .RETURN.B212: .RETURN.B211: .RETURN.B210: .RETURN.B207: .RETURN.B206: .RETURN.B205: .RETURN.B204: .RETURN.B203: .RETURN.B202: .RETURN.B201: .RETURN.B200: .RETURN4.W377: .SETS "Insufficient dynamic storage" .RETURN4.W376: .SETS "Specified task not installed" .RETURN4.W375: .SETS "Partition too small for task" .RETURN=.W374: .SETS "Insufficient dynamic storage for send"N .RETURN'.W373: .SETS "Un-assigned LUN"B .RETURN3.W372: .SETS "Device handler not resident"B .RETURN'.W371: .SETS "Task not active": .RETURN>.W370: .SETS "Directive inconsistent with task state" .RETURN2.W367: .SETS "Task already fixed/unfixed" .RETURN7.W366: .SETS "Issuing task not checkpointable"e .RETURN..W365: .SETS "Task is checkpointable" .RETURN.W364: .RETURN.W363: .RETURN.W362: .RETURN3.W361: .SETS "Receive buffer is too small"T .RETURN+.W360: .SETS "Privilege violation"  .RETURN'.W357: .SETS "Resource in use"E .RETURN/.W356: .SETS "No swap space available"T .RETURN0.W355: .SETS "Illegal vector specified" .RETURN.W354: .RETURN.W353: .RETURN.W352: .RETURN.W351: .RETURN.W350: .RETURN.W347: .RETURN.W346: .RETURN.W345: .RETURN.W344: .RETURN.W343: .RETURN.W342: .RETURN.W341: .RETURN.W340: .RETURN.W337: .RETURN.W336: .RETURN.W335: .RETURN.W334: .RETURN.W333: .RETURN.W332: .RETURN.W331: .RETURN.W330: .RETURN.W327: .RETURN.W326: .RETURN.W325: .RETURN.W324: .RETURN.W323: .RETURN.W322: .RETURN.W321: .RETURN.W320: .RETURN.W317: .RETURN.W316: .RETURN.W315: .RETURN.W314: .RETURN.W313: .RETURN.W312: .RETURN.W311: .RETURN.W310: .RETURN.W307: .RETURN.W306: .RETURN.W305: .RETURN.W304: .RETURN.W303: .RETURN.W302: .RETURN.W301: .RETURN.W300: .RETURN.W277: .RETURN.W276: .RETURN.W275: .RETURN.W274: .RETURN.W273: .RETURN.W272: .RETURN.W271: .RETURN.W270: .RETURN.W267: .RETURN.W266: .RETURN.W265: .RETURN.W264: .RETURN.W263: .RETURN.W262: .RETURN.W261: .RETURN<.W260: .SETS "Directive issued/not issued from AST" .RETURN1.W257: .SETS "Illegal mapping specified"E .RETURN/.W256: .SETS "Invalid escape sequence": .RETURN2.W255: .SETS "Window has I/O in progress" .RETURN'.W254: .SETS "Alignment error". .RETURN:.W253: .SETS "Address window allocation overflow" .RETURN).W252: .SETS "Invalid region ID"6 .RETURN1.W251: .SETS "Invalid address window ID"W .RETURN,.W250: .SETS "Invalid TI parameter" .RETURN=.W247: .SETS "Invalid send buffer size ( .GT. 255.)"g .RETURN).W246: .SETS "LUN locked in use"I .RETURN#.W245: .SETS "Invalid UIC". .RETURN..W244: .SETS "Invalid device or unit" .RETURN/.W243: .SETS "Invalid time parameters"S .RETURN6.W242: .SETS "Partition/region not in system" .RETURN5.W241: .SETS "Invalid priority ( .GT. 250.)"I .RETURN#.W240: .SETS "Invalid LUN": .RETURN6.W237: .SETS "Invalid event flag ( .GT. 64.)" .RETURN8.W236: .SETS "Part of DPB out of user''s space" .RETURN/.W235: .SETS "DIC or DPB size invalid"X .RETURN.W234: .RETURN.W233: .RETURN.W232: .RETURN.W231: .RETURN.W230: .RETURN.W227: .RETURN.W226: .RETURN.W225: .RETURN.W224: .RETURN.W223: .RETURN.W222: .RETURN.W221: .RETURN.W220: .RETURN.W217: .RETURN.W216: .RETURN.W215: .RETURN.W214: .RETURN.W213: .RETURN.W212: .RETURN.W211: .RETURN.W210: .RETURN.W207: .RETURN.W206: .RETURN.W205: .RETURN.W204: .RETURN.W203: .RETURN.W202: .RETURN.W201: .RETURN.W200: .RETURN+.S0: .SETS "Operation in progress"U .RETURN.S1: .SETS "Success": .RETURN231: .RETURN.W230: .RETURN.W227: .RETURN.W226: .RETURN.W225: .RETURN.W224: .RETURN.W223: .RETURN.W222: .RETURN.W221: .RETURN.W220: .RETURN.W217: .RETURN.W216: .RE@Q >OTRN.W211: .RETURN.W210: .RETURN.W207: .RETURN.W206: .RETURN.W205: .RETURN.W204: .RETURN.W203: .RETURN.W202: .RETURN.W201: .RETURN.W200: .RETURN+.S0: .SETS "Operation in progress"U .RETURN.S1: .SETS "Success": .RETURN231: .RETURN.W230: .RETURN.W227: .RETURN.W226: .RETURN.W225: .RETURN.W224: .RETURN.W223: .RETURN.W222: .RETURN.W221: .RETURN.W220: .RETURN.W217: .RETURN.W216: .RE%.;+ INDPRF -- Parse a filename string.;.; COPYRIGHT (c) 1981 BY).; DIGITAL EQUIPMENT CORPORATION, MAYNARD(.; MASSACHUSETTS. ALL RIGHTS RESERVED..;B.; THIS SOFTWARE IS FURNISHED UNDER A LICENSE AND MAY BE USEDB.; AND COPIED ONLY IN ACCORDANCE WITH THE TERMS OF SUCH LICENSEB.; AND WITH THE INCLUSION OF THE ABOVE COPYRIGHT NOTICE. THISB.; SOFTWARE OR ANY OTHER COPIES THEREOF, MAY NOT BE PROVIDED ORB.; OTHERWISE MADE AVAILABLE TO ANY OTHER PERSON. NO TITLE TO AND2.; OWNERSHIP OF THE SOFTWARE IS HEREBY TRANSFERED..;B.; THE INFORMATION IN THIS DOCUMENT IS SUBJECT TO CHANGE WITHOUTB.; NOTICE AND SHOULD NOT BE CONSTRUED AS A COMMITMENT BY DIGITAL.; EQUIPMENT CORPORATION.C.;B.; DIGITAL ASSUMES NO RESPONSIBILITY FOR THE USE OR RELIABILITY OF=.; ITS SOFTWARE ON EQUIPMENT THAT IS NOT SUPPLIED BY DIGITAL.Y.;.;E.; This routine returns a string value in that contains eachOH.; element of the file specification delimited by back slashes. It also<.; returns an exit status of or in .; .enable substitutionU.;<.; breakup a full file spec. First set all variables to null.; .sets file p1 .sets node "" .sets devi "" .sets dire "" .sets filn "" .sets filx "" .sets filv "" .sets swit "" .setf exitF .setf err .sets dlmt ".;/"S .gosub fprs node "::" 6 .gosub chk node  .gosub fprs devi ":" 4a .gosub chk devi  .gosub fprs dire "]" 8. .test direa .if <> 0 .gosub uchk& .if <> 0 .sets dire dire+"]" .gosub arst filn . 9. .gosub arst filx ; 3b .gosub arst filv / 5F .gosub chk filv  .sets swit file .test switd& .if gt 0 .sets swit "/"+switO .SETS NODE+"\"+DEVI+"\"+DIRE+"\"+FILN+"\"+FILX+"\"+FILV+"\"+swite .ift err .exit . .exit :.;.; Subroutine list for file.;.;E.; Common subroutine to isolate next fragment for absolute delimiters .;.fprs: .ift err .or .ift exit .returnc .parse comman " " sym delim ln  .setn maxlen 'ln' .sets 'sym' file. .test delim .setn lendel -2 .sets 'sym' ""h .test file 'delim'. .setn tmpn  .if tmpn = 0 .returnt .sets tmpc file[1:tmpn-1] .test tmpc "/"> .if ne 0 .return& .if tmpn gt maxlen+lendel .goto erret .sets 'sym' file[1:tmpn-1]< .sets file file[tmpn+lendel:*]f .return.erret: .sett erru .return.;H.; Common subroutine to isolate next fragment for elements that could be).; delimited by a number of delimitersl.;.arst: .ift err .or .ift exit .return. .parse comman " " sym delim lnr .setn maxlen 'ln' .test filef .if eq 0 .return .setn fillen .setf eol .setn tmpn 1t.elprs:. .if tmpn gt fillen .goto asne .sets tmpc file[tmpn:tmpn]e .test tmpco .iff .goto asn .inc tmpn .goto elprs.asn: .sets dlm "" .if tmpn gt fillen .sett eol.# .iff eol .sets dlm file[tmpn:tmpn]s .if tmpn gt maxlen+1 .goto errt) .if tmpn gt 1 .sets 'sym' file[1:tmpn-1]f0 .iff eol .if delim eq file[tmpn:tmpn] .inc tmpn! .iff eol .sets file file[tmpn:*]l .ift eol .sett exit .ift eol .sets file ""< .return.errt: .sett err .return.;K.; Subroutine to verify that each element of a given string symbol are of ae.; given class.;.chk:e .parse comman " " sym delim .test 'sym' .if eq 0 .return .setn tmpn .chk1: .sets tmpc 'sym'[tmpn:tmpn] .test tmpcm .iff 'delim' .sett err+ .dec tmpn .if tmpn eq 0 .return .goto chk1m.;1.; Subroutine to verify a directory specification.;.uchk: .parse dire "[," sym dlm ln .test sym .if ne 0 .sett err .test dlm2 .if eq 0 .or .if gt 3 .sett err .gosub chk dlm g .test ln 2 .if eq 0 .or .if gt 3 .sett err .gosub chk ln  .returnsym' .if eq 0 .return .setn tmpn .chk1: .sets tmpc 'sym'[tmpn:tmpn] .test tmpcm .iff 'delim' .sett err+ .dec tmpn .if tmpn eq 0 .return . ABORT[/COMMAND] commandname% ABORT/TASK[/qualifier[s]] [taskname]/ /TERMINAL:ddnn: /[NO]POSTMORTEMF The ABORT command aborts the execution of either a command or a task.F The /TASK qualifier aborts a task running at your terminal. The /TASKA qualifier must be typed in the format show above. If you do notoG specify a task name, the task that you installed using the RUN commandn is aborted by default. E The /TERMINAL qualifier aborts a task running on some terminal othera1 than your own. This is a privileged qualifier. [K The /POSTMORTEM qualifier specifies that a Postmortem Dump be taken of theAI task before it is aborted. The default is /NOPOSTMORTEM. See HELP PMD.A Command abbreviation: Aunning at your terminal. The /TASKA qualifier must be typed in the format show above. If you do notoG specify a task name, the task that you installed using the RUN commandn is aborted by default. E The /TERMINAL qualifier aborts a task running on some terminal othera1 tha.DIFFERENCES[/qualifier[s]] filespec1 filespec2 /CHANGE_BAR[:nnn] /IGNORE:(arg[,s])e BLANK_LINES COMMENTSh FORM_FEEDSa SPACING$ TRAILING_BLANKS /LINES:n /NONUMBERS /OUTPUT:filespecF The DIFFERENCES command compares the contents of two ASCII files and A reports the differences found between them. The default filetypeh for both input files is .MAC.G For a description of each qualifier, type: HELP DIFFERENCES qualifier. 2 IGNORE1 DIFFERENCES/IGNORE:(arg[,s]) filespec1 filespec2  BLANK_LINES COMMENTS  FORM_FEEDS  SPACING TRAILING_BLANKS C The /IGNORE qualifier causes the characteristics specified in the < command argument to be ignored when two files are compared.E If you specify more than one argument to the /IGNORE qualifier, you tB must enclose the arguments in parentheses and separate them with B commas. If you specify only one argument, you can leave out the parentheses.EG For information on individual arguments to the IGNORE qualifier, type:  HELP DIFFERENCES IGNORE arg 3 BLANK_LINES3 DIFFERENCES/IGNORE:BLANK_LINES filespec1 filespec2uB The BLANK_LINES argument specifies that blank lines in both filesD be excluded from the comparison. Otherwise, including blank lines " in the comparison is the default.E If you specify more than one argument to the /IGNORE qualifier, you cB must enclose the arguments in parentheses and separate them with B commas. If you specify only one argument, you can leave out the parentheses.y 3 FORM_FEEDS2 DIFFERENCES/IGNORE:FORM_FEEDS filespec1 filespec2> The FORM_FEEDS argument specifies that lines beginning with a= single form feed character be excluded from the comparison. o8 The default is to include such lines in the comparison.E If you specify more than one argument to the /IGNORE qualifier, you tB must enclose the arguments in parentheses and separate them with B commas. If you specify only one argument, you can leave out the parentheses. 3 COMMENTS0 DIFFERENCES/IGNORE:COMMENTS filespec1 filespec2B The COMMENTS argument specifies that comments--that is, text pre-F ceded by a semicolon (;)--be excluded from the comparison. Otherwise,+ comments are compared like all other text.cE If you specify more than one argument to the /IGNORE qualifier, you eB must enclose the arguments in parentheses and separate them with B commas. If you specify only one argument, you can leave out the parentheses. 3 SPACINGu/ DIFFERENCES/IGNORE:SPACING filespec1 filespec2I> The SPACING argument specifies that any sequence of blank andF tab characters is to be interpreted as a single blank for the compar-D ison. This argument is useful when source files that differ only inE their spacing are being compared. The output listing includes blanks C and tabs as they are found in the input files, but the blanks and rF tabs are ignored in the comparison. Normally, sequences of blanks and. tabs are compared like any other characters. E If you specify more than one argument to the /IGNORE qualifier, you fB must enclose the arguments in parentheses and separate them with B commas. If you specify only one argument, you can leave out the parentheses.f3 TRAILING_BLANKSl7 DIFFERENCES/IGNORE:TRAILING_BLANKS filespec1 filespec2 F The TRAILING_BLANKS argument specifies that all blanks following the B last nonblank character in a line be ignored. If you include thisD argument with the NOCOMMENTS argument, blanks preceding a semicolon are also ignored. aE If you specify more than one argument to the /IGNORE qualifier, you tB must enclose the arguments in parentheses and separate them with B commas. If you specify only one argument, you can leave out the parentheses.F 2 CHANGE_BAR1 DIFFERENCES/CHANGE_BAR[:nnn] filespec1 filespec2ND The /CHANGE_BAR qualifier specifies that the output listing consistF of a copy of the second input file with change bars next to each lineB that does not have a corresponding line in the first input file. E The default change bar is the exclamation point (!). The argument, ,B nnn, is the octal value of the ASCII character you wish to use as@ the change bar. Type HELP ASCII for the octal values of ASCII characters.2 LINES( DIFFERENCES/LINES:n filespec1 filespec2G The /LINES qualifier specifies that n lines must be identical before ap match is recognized.  The default value is /LINES:3.h 2 NONUMBERSn* DIFFERENCES/NONUMBERS filespec1 filespec2D The /NONUMBERS qualifier specifies that lines appear in the output  listing without line numbers. mD The standard output listing has numbered lines, beginning with the F number one: this is the default. Line numbers are incremented by one' for each line, including blank lines. N2 OUTPUT0 DIFFERENCES/OUTPUT:filespec filespec1 filespec2F The /OUTPUT qualifier writes the output listing to the file named in I the filespec argument. Normally, this output appears on your terminal. lD If you specify /OUTPUT:LP:, the output listing appears on LP0:, if your system has a line printer.mbers. mD The standard output listing has numbered lines, beginning with the F number one: this is the default. Line numbers are incremented by one' for each line, including blank lines. N2 OUTPUT0 DIFFERENCES/OUTPUT:filespec filespec1 filespec2F The /OUTPUT qualifier writes th/ LINK[/qualifier[s]] filespec[s][/qualifier[s]] NC The LINK command invokes the Task Builder to build a runnable taskLA from object modules you have previously compiled (or assembled).  t The command B, $ LINK filespec1[.OBJ],filespec2[.OBJ],...  fD builds a runnable task image from an object file (the output of theD MACRO-11 assembler or of a high-level language compiler). The task D image file has the same name as the object file, with the file typeC .TSK. If more than one filespec is specified, the task image file[G has the same file name as the first input filespec, but with the file l type .TSK. E Type HELP LINK MORE for more LINK information, HELP LINK QUALIFIERS F for a list of LINK qualifiers, HELP LINK qualifier for an individualA qualifier description, HELP LINK C81 for information on linkinge6 COBOL-81 object files to produce a task image (.TSK).2 MORE LINK has the general form of 7 $ LINK/qualifier:outfile/qualifier infile/qualifierrB The space in the command separates input files from output files.3 Standard qualifiers are included in the next form:i9 $ LINK/TASK:fname/MAP:fname/SYM:fname/OPTIONS:fname -r -> infile/qualifier[s]G TAS or TASK produces the .TSK (task) file and can be named with fname.> MAP produces the .MAP (map) file and can be named with fname.E SYM or SYMBOL_TABLE produces the .STB symbol definition file and canN be named with fname.oB OPTIONS causes prompting for Task Builder options. OPTIONS:fspecF causes the options to be read from the file named in fname. The fileC must contain the options, each on a single line. There must be no/> slashes in this file, and the file must have a .CMD filetype. C A hyphen (-) in the command line causes continuation. Include theeF space before the hyphen if the hyphen is just before the input files. For example:E3 $ LINK/TASK:fname/MAP:fname/SYM:fname/OPTIONS - ->infile1,infile2/QUALIFIERS Options? o $ @ Pressing RETURN in place of entering input files causes LINK to prompt you for them..B Type HELP LINK qualifier for individual qualifier descriptions or6 HELP LINK OPTIONS for a list of Task Builder options.2 ANCILLARY_PROCESSOR/ LINK/TAS/MAP/SYM/ANCILLARY_PROCESSOR[:n] INPUTt .: /ANCILLARY_PROCESSOR identifies the task as an AncillaryA Control Processor (ACP). The parameter n specifies the first APR/D used by the ACP. Acceptable values are 0, 4, or 5. The default is 5.  o Abbreviation: /ANC:nE4 /ANC:n corresponds to the /AC switch in TKB format." Default: An ACP is not specified.2 BASICe LINK inputfile/BASICi> /BASIC specifies that the input file is a .CMD (command) fileD created by the BASIC-PLUS-2 compiler. /BASIC may affect any output% file. Do not modify the .CMD file.  Abbreviation: /BASa# There is no equivalent TKB switch. 2 Default: No BASIC-PLUS-2 command file is created.2 NOCHECKPOINT #CHECKPOINT0 2 CHECKPOINT+ LINK/TAS/MAP/SYM/CHECKPOINT[:SYSTEM] INPUTE) LINK/TAS/MAP/SYM/CHECKPOINT[:TASK] INPUTn BC /CHECKPOINT specifies that the task is to be built checkpointable.f4 The default is a task that cannot be checkpointed.  .' Abbreviation: /CHECK:SYS or /CHECK:TAS-E SYSTEM is the default and specifies task checkpointing to the system C checkpoint file. This is the default if checkpointing is required.wA TASK specifies task checkpointing into its own checkpoint space.CD Tasks built with the /CHECKPOINT:TASK qualifier take up about twiceC as much as disk space because space is allocated in the task imageI file for checkpointing. C /CHECKPOINT corresponds to the /AL and /CP switches in TKB format.h) Default: Checkpointing is not specified.r 2 COMPATIBLE" LINK/TAS/MAP/SYM/COMPATIBLE INPUT tA /COMPATIBLE specifies the memory-resident overlay segments to bea< aligned on 256-word boundaries for compatibility with other+ implementations of the mapping directives.T s Abbreviation: /COMKF Normally, the memory-resident overlay segments are aligned on 32-word boundaries. 9 /COMPATIBLE corresponds to the /CM switch in TKB format.I5 Default: Segments are aligned on 32-word boundaries.h2 NOCONCATENATEc #CONCATENATE 2 CONCATENATE+ LINK/TAS/MAP/SYM filespec/[NO]CONCATENATE P A /NOCONCATENATE includes only the first module of the input file b% to which this qualifier is attached. A /CONCATENATE includes all the modules of the input file to whichT this qualifier is attached. N a Abbreviation: /CON or /NOCONy: /CONCATENATE corresponds to the /CC switch in TKB format.9 Default: All modules in the input file are concatenated. 2 CRFs#CROSS_REFERENCE2 NOCROSS_REFERENCE #CROSS_REFERENCE2 CROSS_REFERENCE + LINK/TAS/MAP/SYM/[NO]CROSS_REFERENCE INPUTE EE /CROSS_REFERENCE causes the ..CRF system task to append a listing ofe7 symbol cross-references to the Task Builder map file. TD /CROSS_REFERENCE causes LINK to include the /MAP qualifier as well.A You do not need to specify the /MAP qualifier unless you want to " specify a name for the map file.  Abbreviation: /CROS or /NOCROSn> /CROSS_REFERENCE corresponds to the /CR switch in TKB format.= Default: /NOCROSS_REFERENCE; no cross-reference is produced./2 DEBUG ( LINK/TAS/MAP/SYM/DEBUG[:filespec] INPUT CB /DEBUG causes the inclusion of a debugging aid in the task image.E With no debugging aid specified in filespec, TKB links the task withsD the Online Debugging Tool (ODT), a DIGITAL utility included in most/ RSX-11M, RSX-11M-PLUS, and Micro/RSX systems. i aE If you have a user-written debugger, you may specify it in filespec._' This file should be an object module. n B Abbreviation: /DEB[:filespec]4 /DEBUG corresponds to the /DA switch in TKB format./ Default: No debugger is linked with the task. 2 DEFAULT_LIBRARYn6 LINK/TAS/MAP/SYM filespec1,filespec2/DEFAULT_LIBRARY  aB /DEFAULT_LIBRARY specifies that the object library to which it isA applied, rather than LB0:[1,1]SYSLIB.OLB, be used as the default-C library that is searched to resolve unresolved global references. e g+ You may apply /DEF to one input file only.i Abbreviation: /DEFm> /DEFAULT_LIBRARY corresponds to the /DL switch in TKB format.2 Default: No default library is specified or used.2 DUMP #POSTMORTEM 2 POSTMORTEM" LINK/TAS/MAP/SYM/POSTMORTEM INPUT e7 /POSTMORTEM specifies that a Postmortem Dump (PMD) be pC generated if the task terminates abnormally. The PMD task must be C installed in your system for this switch to be effective. See HELPe PMD.s Abbreviation: /POSr9 /POSTMORTEM corresponds to the /PM switch in TKB format.i: Default: Not /POSTMORTEM; no postmortem dump takes place.2 FAST i LINK/TAS/MAP/SYM/FAST INPUT oF /FAST specifies that the Fast Task Builder be used to build the task.C The Fast Task Builder is considerably faster than the default Taska Builder.  DC Several restrictions apply to tasks built by the Fast Task BuilderD (FTB). FTB does not support: s o New map format o Overlaid tasks o Privileged tasks& o Creation of resident libraries$ o Linking to cluster libraries( o Production of symbol table files o FORTRAN virtual arrays9 The LINK command is limited to the following qualifiers:u /[NO]PRINTb /[NO]CHECKPOINT[:SYSTEM]B /CROSS_REFERENCEf /CODE:FPP /CODE:EAE /[NO]MEMORY_MANAGEMENTc /DEBUG[:filespec] /LONG /MAP[:filespec] /WIDE /LIBRARY; The Fast Task Builder is limited to the following options:v? ACTFIL, ASG, COMMON, EXTSCT, LIBR, MAXBUF, RESCOM, RESLIB,k' RESSUP, STACK, SUPLIB, TASK, UNITSi> In addition, the map format is non-standard and undocumented. Abbreviation: /FASd7 Default: Not /FAST; the standard Task Builder is used.]2 FULL_SEARCH # LINK/TAS/AMP/SYM/FULL_SEARCH INPUTO F? /FULL_SEARCH specifies that the Task Builder should search alllB co-tree (overlay) segments for a matching definition or reference@ when processing modules from the default object module library. Abbreviation: /FULN: /FULL_SEARCH corresponds to the /FU switch in TKB format.E Default: Not /FULL_SEARCH; TKB limits its search to the root of the u# main tree and to the current tree. 2 NOGLOBALS #GLOBALS 2 GLOBALSa LINK/TAS/MAP/SYM INPUT/GLOBALS" LINK/TAS/MAP/SYM INPUT/NOGLOBALS OE /GLOBALS specifies that global symbols referenced and defined by the) input file be included in the .MAP file.dC /NOGLOBALS specifies that global symbols referenced and defined byt1 the input file be excluded from the .MAP file. S Abbreviation: /GLOe6 /GLOBALS corresponds to the /MA switch in TKB format.B Default: /GLOBALS; global symbols are included in the .MAP file. 2 NOHEADER#HEADERL2 HEADER LINK/TAS/MAP/SYM/NOHEADER INPUT LINK/TAS/MAP/SYM/HEADER INPUTE /NOHEADER specifies that the task be built without a task header. IfdF you are building a shared region or a driver, you should specify thisE qualifier. /NOHEADER corresponds to the /-HD switch in TKB format. iE /HEADER specifies that the task be built with a task header. A task/D header is necessary if the task is to run. /HEADER corresponds to  the /HD switch in TKB format.. The STACK=0 option must be used with /HEADER. Abbreviation: /HEA or /NOHEA3 Default: /HEADER; the task is built with a header.i 2 IO_PAGE  LINK/TAS/MAP/SYM/IO_PAGE INPUTeD /NOIO_PAGE informs the Task Builder that the task is over 12K words and need not map the I/O page.rA Conversely, if you use the /IO_PAGE qualifier, the Task Builder aF assumes that the task is over 12K words in size and must map the I/O  page. Abbreviation: /IO or /NOIOn: /IO_PAGE corresponds to the use of the /IP switch in TKB.C Default: /IO_PAGE; TKB assumes that the 12K task is to map the I/Ot page.2 LONG LINK/TAS/MAP/SYM INPUT @ /LONG specifies that the .MAP file produced by the Task BuilderA include additional file information on modules used in the task F build. The long map does not include file information on modules from the system library. tF If you include /LONG, LINK creates the /MAP qualifier as well. You doE not need to explicitly specify /MAP unless you want to supply a nameI for the map file. D Abbreviation: /LONs4 /LONG corresponds to the /-SH switch in TKB format.F Default: Not /LONG; TKB does not include additional file information.2 MAPb9 LINK/TAS/MAP[:filespec]/SYM infilespec1,infilespec2,... B /MAP specifies that a .MAP file is to be produced. The .MAP fileD appears in your UFD. The default name for the map file is the same0 as that of the first input file (infilespec1). A If you specify a filespec for the map file, the file appears in y@ your UFD. You can print the map file with the /PRINT qualifier? only if the task QMGPRT.TSK is installed on your system as theN= PRT... task. You may prevent printing by using the /NOPRINTL qualifier.f Abbreviation: /MAP1? /MAP corresponds to the position of the .MAP filespec in TKB. d5 Default: Not /MAP; TKB does not produce a .MAP file.n2 NOMEMORY_MANAGEMENT #MEMORY_MANAGEMENT2 MEMORY_MANAGEMENTe- LINK/TAS/MAP/SYM/MEMORY_MANAGEMENT[:n] INPUTf/ LINK/TAS/MAP/SYM/NOMEMORY_MANAGEMENT[:n] INPUT. o@ /MEMORY_MANAGEMENT specifies that the task is being built for a@ system with memory management hardware. The value n is ignored with this qualifier. B /NOMEMORY_MANAGEMENT specifies that the task is being built for aF system without the memory management hardware. This is useful if youC are are building tasks to be run on unmapped RSX-11M systems. The D decimal value n (in K-words) specifies the highest physical address? of a task on the target system; it can be 28 or 30. Without nN specified, the default is 28. c Abbreviation: /MEM or /NOMEM @ /MEMORY_MANAGEMENT corresponds to the /MM switch in TKB format.B Default: Without either qualifier, allocates memory according to = the status of the system on which the task is being built. m 2 NOSEGREGATET #SEGREGATE 2 SEGREGATEe% LINK/TAS/MAP/SYM/[NO]SEGREGATE INPUTe? /SEGREGATE allocates virtual address space containing program hG sections contiguously; first to the read-write (RW) program sections, 2 and then to the read-only (RO) program sections. E /SEGREGATE allows control over program section ordering. /SEGREGATEtE orders program sections aphabetically by name within access code (RWo followed by RO).iF /SEQUENTIAL with /SEGREGATE orders program sections in input order byD access code. /SEQUENTIAL with /NOSEGREGATE orders program sections5 in input order with RW and RO sections interleaved. : /NOSEGREGATE interleaves the RW and RO program sections. 8 /NOSEQUENTIAL with /NOSEGREGATE orders program sections6 alphabetically with RW and RO sections interleaved. @ /SHAREABLE:TASK causes the Task Builder to use /SEGREGATE. To = correctly build shareable task, you can use only /SEGREGATE.R Abbreviation: /SEG or /NOSEGA7 /SEGREGATE corresponds to the Task Builder /SG switch.  Default: /NOSEGREGATE 2 MULTIUSERr #SHAREABLE 2 SHAREABLE ' LINK/TAS/MAP/SYM/SHAREABLE[:arg] INPUT." COMMON# LIBRARYU TASKC The COMMON argument identifies a multiuser common. In TKB format,- apply the /CO switch to the .TSK filespec. s SE The LIBRARY argument identifies a multiuser library. In TKB format,E. apply the /LI switch to the library filespec.C TASK identifies a multiuser task. TASK causes the Task Builder toGD divide the task into two regions: region 0 contains the read-writeA portion of the task and region 1 contains the read-only portion. @ /SHAREABLE:TASK identifies the task as multiuser, or shareable.@ Multiuser tasks allow more than one user to share the read onlyF portions of a single task. In TKB format TASK corresponds to the /MU> switch. The TASK qualifier is valid only on RSX-11M-PLUS and Micro/RSX. / Abbreviations: /SHA:COM, /SHA:LIB, or /SHA:TASrB Default: /SHAREABLE without an argument uses TASK as the default 2 OPTIONS @TKBOPTs2 OVERLAY_DESCRIPTIONi+ LINK/TAS/MAP/SYM/OVERLAY_DESCRIPTION INPUT- yB /OVERLAY_DESCRIPTION names an overlay description file (.ODL fileF type) that controls the linking of the task. No other input file canE be specified if you use this qualifier. The .ODL file specifies the/, input files and their to the Task Builder.   Abbreviation: /OVE B /OVERLAY_DESCRIPTION corresponds to the /MP switch in TKB format.: Default: None. No overlay description file is specified. 2 NOPRINT #PRINT2 PRINTR LINK/TAS/MAP/SYM/PRINT INPUT/9 /NOPRINT prevents spooling the .MAP file to the printer.eB /PRINT allows spooling of the .MAP file only if the QMGPRT.TSK in- your system is installed as the PRT... task.  Abbreviation: /NOPRIN or /PRIN.- /PRINT corresponds to the /SP switch in TKB.tA Default: /PRINT; the map file is printed if PRT... is installed.C 2 PRIVILEGED& LINK/TAS/MAP/SYM/PRIVILEGED[:n] INPUT D@ /PRIVILEGED indicates that the task is privileged. The optionalF parameter n specifies the base relocation register. Acceptable valuesE are 0, 4, or 5. The default, if the octal number n is not specified,f is 5.  Abbreviation: /PRIV:n3 /PRIV corresponds to the /PR switch in TKB format.1 Default: None. No privileged task is specified.d 2 QUALIFIERS Command qualifiers:1 /OPTIONSi= /ANCILLARY_PROCESSOR[:n] /OVERLAY_DESCRIPTIONT4 /[NO]CHECKPOINT:arg /POSTMORTEM5 SYSTEM /[NO]PRINTERa9 TASK /PRIVILEGED[:n] u5 /CODE:arg /[NO]RECEIVE? DATA_SPACE /[NO]RESIDENT_OVERLAYSi. EAE /SAVE7 FPP /[NO]SEGREGATE> PIC /[NO]SELECTIVE_SEARCH4 POSITION_INDEPENDENT /SEQUENTIAL9 /COMPATIBLE /SHAREABLE[:arg] : /[NO]CROSS-REFERENCE COMMON; /[NO]DEBUG[:filespec] LIBRARY 8 /ERROR_LIMIT:n TASK/ /[NO]EXECUTABLE[:filespec] /SLAVE. /[NO]EXTERNAL /SLOWB /FAST /SYMBOL_TABLE[:filespec] D /FULL_SEARCH /[NO]SYSTEM_LIBRARY_DISPLAY= /[NO]HEADER /[NO]TASK[:filespec] - /IO_PAGE /TKBE/ /LONG /TRACEN6 /MAP[:filespec] /[NO]WARNINGS2 /[NO]MEMORY_MANAGEMENT[:n] /[NO]WIDE Filespec Qualifiers::F /BASIC /INCLUDE:(module1,...modulen)1 /[NO]CONCATENATE /LIBRARYY= /DEFAULT_LIBRARY /OVERLAY_DESCRIPTION : /[NO]GLOBALS /SELECTIVE_SEARCH 2 DATA_SPACE#CODEe2 EXTENDED_ARITHMETIC #CODE 2 EAE #CODE 2 FLOATING_POINT#CODE 2 FPP #CODE 2 PIC/#CODE2 POSITION_INDEPENDENT#CODE 2 CODE& LINK/TAS/MAP/SYM/CODE:(arg[,s]) INPUT" DATA_SPACE EAE  FPP/ PIC- POSITION_INDEPENDENT R D /CODE describes the source code for the task or shared region being built.  C Abbreviation: /COD:DAT, /COD:EAE, /COD:FPP, /COD:PIC, or /COD:POS X DE The DATA_SPACE argument specifies that the task employs user-mode I- < and D-space. In TKB format, use the /ID switch on the .TSK filespec. / /E The EAE argument specifies that the code assumes the presence of the C optional Extended Arithmetic Element hardware. In TKB format, use ( the /EA switch on the .TSK filespec. A The FPP argument specifies that the code assumes the presence ofsD the optional Floating Point Processor hardware. In TKB format, use& the /FP switch on the .TSK filespec. F The PIC and POSITION_INDEPENDENT arguments are synonomous and specifyG that the shared region (common or library) being built is relocatable./A In TKB format, use the /PI switch on the .TSK or .STB filespec. C If you combine arguments, enclose them in parentheses and separates them with commas. ; Abbreviations: /COD:DAT, /COD:EAE, /COD:FPP, /COD:PIC, andc /COD:POS @ Defaults: Not /CODE:DATA_SPACE, not /CODE:EAE, not /CODE:FPP on@ RSX-11M, /CODE:FPP on RSX-11M-PLUS, /CODE:FPP on Micro/RSX with5 the Floating Point Processor, not /CODE:PIC, and nota /CODE:POSITION_INDEPENDENT.2 SAVE LINK/TAS/MAP/SYM/SAVE INPUT rC /SAVE preserves the indirect command file created by LINK to passfE commands to the Task Builder. This file, named ATLNK.TMP, consists dG TKB commands translated from your LINK command. You can use this file CC to duplicate the task build, using a LINK command in the following, form: E $ LINK @ATLNK.CMDR 1F You should rename ATLNK.TMP if you want to save it. A new file called: ATLNK.TMP is created each time you issue a LINK command. 2 NOEXTERNAL #EXTERNALN 2 EXTERNAL / LINK/TAS/MAP/SYM/EXTERNAL INPUT" LINK/TAS/MAP/SYM/NOEXTERNAL INPUT KM /NOEXTERNAL specifies that the task is being built to run with its header ins Executive pool space.E /EXTERNAL specifies that the task's header is adjacent to the space a in which the task is installed. Abbreviation: /NOEXT or /EXT E /EXTERNAL corresponds to the /XH switch in TKB format. /EXTERNAL is.* valid only on RSX-11M-PLUS and Micro/RSX.B Default: /EXTERNAL for RSX-11M-PLUS and Micro/RSX. Overridden by) /EXTERNAL_HEADER in the INSTALL command.N 2 NORECEIVE #RECEIVE I 2 RECEIVE/ LINK/TAS/MAP/SYM/RECEIVE INPUTk! LINK/TAS/MAP/SYM/NORECEIVE INPUTd i> /RECEIVE specifies that the task may receive messages via the Executive Send directive. sD /NORECEIVE specifies that the task may not recieve messages via the Executive Send directive. Abbreviation: /REC or /NOREC / /RECEIVE corresponds to the /SE switch in TKB.r Default: /RECEIVE2 NORESIDENT_OVERLAYSS#RESIDENT_OVERLAYS2 RESIDENT_OVERLAYSL= LINK/TAS/MAP/SYM/RESIDENT_OVERLAYS INPUT/OVERLAY_DESCRIPTIONE@ LINK/TAS/MAP/SYM/NORESIDENT_OVERLAYS INPUT/OVERLAY_DESCRIPTION  F /RESIDENT_OVERLAY enables recognition of the memory- resident overlayC operator (!) in an overlay description file. This is the default. s> The /NORESIDENT_OVERLAY qualifier disables recognition of theB memory-resident overlay operator in an overlay description file.  c Abbreviation: /RES or /NORESE? /RESIDENT_OVERLAY corresponds to the /RO switch in TKB format. N@ Default: /RESIDENT_OVERLAY; TKB recognizes the memory-resident  overlay operator.2 SELECTIVE_SEARCH) LINK/TAS/MAP/SYM INPUT/SELECTIVE_SEARCH e lE /SELECTIVE_SEARCH instructs the Task Builder to search the file onlyrF for undefined references to global symbols. /SELECTIVE_SEARCH is most> useful when building an Ancillary Control Processor or other . privileged task that maps into the Executive.B If you do not use this qualifier, TKB includes all global symbols( from the input file in the task image.  Abbreviation: /SELB? /SELECTIVE_SEARCH corresponds to the /SS switch in TKB format.E Default: Not /SELECTIVE_SEARCHT 2 SEQUENTIAL" LINK/TAS/MAP/SYM/SEQUENTIAL INPUT sE /SEQUENTIAL directs the Task Builder to construct a task image from B program segments, in the order in which they appear. Normally theE Task Builder finds all program sections referenced in all modules inc@ an overlay segment, and then builds the task with those program! sections in alphabetical order. # See also the /SEGREGATE qualifier.B? The Task Builder groups the program section by access-code (RWEA followed by RO). Then within that grouping arranges the programY9 sections in the order in which they appear in the code. eC Do not use this qualifier to build tasks that rely on alphabeticalwE allocation of program sections (such as FORTRAN I/O handling moduless and FCS modules from SYSLIB). a Abbreviation: /SEQt9 /SEQUENTIAL corresponds to the /SQ switch in TKB format.i Default: Not /SEQUENTIAL 2 SLAVE  LINK/TAS/MAP/SYM/SLAVE INPUTeC /SLAVE specifies that the task be slaved to a sending task. When ae= slaved task successfully executes the RECEIVE DATA Executiveo= directive, it is given the UIC and TI: of the sending task. aF A slaved task cannot be run with a RUN command. It must be run by the sending task. FB A slaved task running on a virtual terminal cannot receive data.  Abbreviation: /SLA 5 /SLAVE corresponds to the /SL switch in TKB format.  Default: Not /SLAVE2 SLOW LINK/TAS/MAP/SYM/SLOW INPUT UF /SLOW specifies that the Slow Task Builder be used to build the task.C You should specify the Slow Task Builder only if your link or taskd- build produces the following error message: n, LIN -- No virtual memory storage available F The default Task Builder and the Fast Task Builder use a symbol tableA structure which can be searched quickly, but which requires moreoB workfile space than the Slow Task Builder. If you receive the LINA error message, you have the choice of reducing workfile size as/? described in the Task Builder Manual or of using the Slow Tasks Builder. @ Except for the use of the different symbol table structure, theC default Task Builder and the Slow Task Builder are identical. All C qualifiers to LINK and all TKB options are available for the Slowl Task Builder. t Abbreviation: /SLOcE The use of /SLOW corresponds to specifying the Slow Task Builder on e your system.d6 Default: Not /SLOW; the default Task Builder is used.2 STOP #ERROR_LIMIT 2 ERROR_LIMIT& LINK/TAS/MAP/SYM/ERROR_LIMIT:n INPUT A /ERROR_LIMIT directs the Task Builder to abort the build after ne? diagnostic errors have been produced. More than n errors are S- unacceptable. Enter n as a decimal number. r Abbreviation: /ERR:n ; /ERROR_LIMIT corresponds to the /XT switch in TKB format. t$ Default: /ERROR_LIMIT:5 is assumed.2 SYMBOL_TABLE+ LINK/TAS/MAP/SYMBOL_TABLE[:filespec] INPUT DD /SYMBOL_TABLE specifies that a symbol definition file be produced. B If the filespec argument is not specified, the symbol definitionC file is given the same name as that of the first input file. Thea file type is .STB. n Abbreviation: /SYM[:filespec]= /SYMBOL_TABLE corresponds to the positional placement of theo .STB filespec in TKB.7 Default: None. No symbol definition file is produced.u2 NOSYSTEM_LIBRARY_DISPLAY#SYSTEM_LIBRARY_DISPLAY/2 SYSTEM_LIBRARY_DISPLAY p. LINK/TAS/MAP/SYM/SYSTEM_LIBRARY_DISPLAY INPUT0 LINK/TAS/MAP/SYM/NOSYSTEM_LIBRARY_DISPLAY INPUTG /SYSTEM_LIBRARY_DISPLAY directs the Task Builder to include in the map B file the names of routines it has added to your task from SYSLIB.C It also includes in the .MAP file global symbols contained in the tF symbol definition file of any shared region to which the task refers.E Those global symbols are those defined by or referenced by the task.LF This map is usually longer than the default map. The map informationE displays the contributions that SYSLIB or the shared regions make toL the task. /? If you include /SYSTEM_LIBRARY_DISPLAY, LINK includes the /MAPaD qualifier as well. You do not have to specify /MAP unless you want$ to supply a name for the map file. & Abbreviation: /SYSTEM_LIBRARY_DISPLAYE /SYSTEM_LIBRARY_DISPLAY corresponds to the /MA switch in TKB format.o# Default: /NOSYSTEM_LIBRARY_DISPLAYe2 NOEXECUTABLE#TASK 2 EXECUTABLE#TASKl2 NOTASK#TASKf2 TASK # LINK/TASK[:filespec]/MAP/SYM INPUTo LINK/NOTASK/MAP/SYM INPUT s$ /EXECUTABLE and /TASK are synonyms.C /TASK specifies that the Task Builder should generate a task imageaF file. This is the default. If a filespec is not specified, the taskD image file is given the same name as the first input file, with the file type .TSK. AB /NOTASK specifies that the Task Builder should not produce a taskE image file. /NOTASK is useful when you want to use some facility oflD the Task Builder without building a task, for example, to generate new map file. M Abbreviation: /TASEA /TAS corresponds to the positional task filespec of .TSK in TKB.o Default: /TAS2 TKB LINK/TAS/MAP/SYM/[TKB] INPUTf fC /TKB specifies that the default Task Builder be used to build thee@task. /TKB is the default and is included for DCL completenessonly.i2 TRACEh LINK/TAS/MAP/SYM/TRACE INPUT A /TRACE specifies that the task is traceable. When you use this aF qualifier, a trace trap occurs on the completion of each instruction  when the task is run. M Abbreviation: /TRAE2 /TRA corresponds to the /TR switch in TKB format. Default: Not /TRACE 2 NOWARNINGS #WARNINGSN 2 WARNINGS LINK/TAS/MAP/SYM/WARNINGS INPUT@ /NOWARNINGS prevents the following two diagnostic messages from appearing:t( o n Undefined symbols segment seg-name= o Module module-name multiply defined p-section p-sect-name  Abbreviation: /NOWAR or /WAR 6 /WARNINGS corresponds to the /NM Task Builder switch.( Default: /WARNINGS; the messages occur.2 NOWIDE#WIDEb2 WIDE LINK/TAS/MAP/SYM/WIDE INPUT LINK/TAS/MAP/SYM/NOWIDE INPUT C /WIDE specifies that the Task Builder map be printed in 132-column/C format. /NOWIDE specifies that the Task Builder map be printed ing narrow 80-column format.  Abbreviation: /WIDe3 /WIDE corresponds to the /WI switch in TKB format.l Default: /NOWIDEo 2 LIBRARYm' LINK/TAS/MAP/SYM INPUT1,INPUTN/LIBRARY/A /LIBRARY identifies the input file as an object module library. R= o The library file must contain relocatable object modules.AA o The library file must be to the right of the string of input s? files that contain references to be defined in the library.N= o If you use the library file more than once in a continued A command line, you must also use /LIBRARY again. For example, 1 $ LINK/TAS/MAP/SYM INPUT1,INPUT2/LIBRARY-& ->INPUT3,INPUT4,INPUT2/LIBRARYB o /LIBRARY is used as the Task Builder switch /LB within overlay< .ODL files to define libraries to the overlay structure. Abbreviation: /LIB 9 /LIBRARY corresponds to the use of the /LB switch in TKBs Default: Not /LIBRARY 2 INCLUDEo; LINK/TAS/MAP/SYM INPUT1,.../INCLUDE(:module1,...,modulen) l o? /INCLUDE is used with an input file that is a library, and is ( prohibited for any other type of file. E /INCLUDE causes TKB to extract from the library the modules named as2E arguments of the qualifier regardless of whether the modules containo( definitions for unresolved references. F You can use /INCLUDE to specify up to eight module names, enclosed inC parentheses and separated by commas. In this case, TKB takes onlyNA those modules from the library. The default filetype for theselB modules is .OBJ. The module names are defined at assembly time. D You can use the /SELECTIVE_SEARCH qualifier in the command sequenceE with both the /LIBRARY or /INCLUDE qualifiers to perform a selectivef search for global definitions.  Abbreviation: /INC: s@ /INCLUDE corresponds to using the /LB switch in TKB with module? qualifiers as, /LB:module1,module2,...,modulen. Exceptions: 6 o The library file has a default filetype of .OLB.> o The library file from which TKB extracts modules can be ' anywhere in the input file stringl= o The library file with the /INCLUDE qualifier can appearo. more than once in the input file string.D o Do not use the /CONCATENATE qualifier in the same command line with /INLCUDENE o You may use /LIBRARY and /INCLUDE in the same command line, but; you must specify the library name for each qualifier.: Default: Not /INCLUDEe2 C81d+ LINK/C81[/qualifier[s]] inputfilespec[,s] , LINK/COBOL[/qualifier[s]] inputfilespec[,s]B Using the LINK/C81 command, you can link COBOL-81 object files to" produce a task image (.TSK) file. The qualifiers are: h1 /[NO]FMS /FMS:NORESIDENT /[NO]MAP /[NO]DEBUG T TE Although the format shows the qualifiers as command qualifiers, you E can append them to either the command or a file specification. When B you use the LINK/C81 command, the two locations are equivalent.  N1 For further help on the above qualifiers, type: p ,' HELP LINK C81 qualifiernamee 3 [NO]FMS#FMS3 FMS:RESIDENT#FMS3 NOFMSl#FMS3 FMSo#FMS:NORESIDENTp3 FMSa /[NO]FMS  /FMS:[NO]RESIDENTD /FMS causes LINK/C81 to include the Forms Management Services (FMS)C library support in your task image. You must use /FMS if you call,! FMS routines from your program. t@ /NOFMS causes LINK/C81 not to include FMS support. This is the default. ; /FMS:NORESIDENT causes LINK/C81 to include support for a o5 non-memory-resident FMS library in your task image. u3 NOMAPm#MAP3 MAPB /MAP causes LINK/C81 to produce a Task Builder map file with the file type .MAP. MF /NOMAP causes LINK/C81 not to produce a memory map file. This is the default.c 3 NODEBUGl#DEBUG3 DEBUG /[NO]DEBUG F The /DEBUG qualifier causes LINK/C81 to include the COBOL-81 Symbolic Debugger in your task iamge. D To use /DEBUG, you must also use the /DEBUG qualifier to the COBOL command.  The default is /NODEBUG. -memory-resident FMS library in your task image. u3 NOMAPm#MAP3 MAPB /MAP causes LINK/C81 to produce a Task Builder map file with the file type .MAP. MF /NOMAP causes LINK/C81 not to produce a memory map file. Thi< MACRO[/qualifier[s]] filespec[/qualifier[s]][,filespec[,s]]3 Command Qualifiers File QualifiersL, /[NO]CROSS_REFERENCE /LIBRARY+ /[NO]LIST[:filespec] /PASS:nh$ /[NO]OBJECT[:filespec] 4 /[NO]WIDE /CROSS_REFERENCE) /DISABLE:(argument[,s]) /LISTa- /ENABLE:(argument[,s]) /[NO]WIDEg- /[NO]SHOW:(argument[,s]) /[NO]SHOWnF MACRO invokes the MACRO-11 Relocatable Assembler, which assembles one? or more MACRO-11 source files into a single relocatable objecta@ module. You can then issue the LINK command to invoke the Task( Builder to process this object module. 1 For more information, type HELP MACRO qualifier.p2 NOCROSS_REFERENCEN#CROSS_REFERENCE2 CROSS_REFERENCESA MACRO/[NO]CROSS_REFERENCE filespec[/qualifier[s]][,filespec[,s]]r= MACRO[/qualifier[s]] filespec/CROSS_REFERENCE[,filespec[,s]] A The /CROSS_REFERENCE qualifier produces a listing that includes eE cross-references to symbols that appear in the source program. This lB cross-reference listing is appended to the assembly listing. The > cross-references are helpful in debugging and in reading long- programs. /NOCROSS_REFERENCE is the default.C /CROSS_REFERENCE as a command qualifier causes the cross-referenceCC listing to be printed on the line printer and placed in your UFD. fA /CROSS_REFERENCE as a filespec qualifier places the file in yourE@ directory, but does not pass the file to the line printer. TheB listing file is assigned the same name as the name of the file to which it is attached. E This listing-related qualifier also implies /LIST. If you use this gE qualifier, you do not need to specify /LIST unless you want to give G a listing file a name different from that of the file in the command. s 2 LIBRARYi3 MACRO[/qualifier[s]] filespec/LIBRARY,filespec[,s]/B The /LIBRARY qualifier specifies that the file is a macro libraryD containing source macro definitions. The default extension for this file is .MLB.2 NOLIST#LISTs2 LIST= MACRO/LIST[:filespec] filespec[/qualifier[s]][,filespec[,s]]a2 MACRO[/qualifier[s]] filespec/LIST[,filespec[,s]]4 MACRO/NOLIST filespec[/qualifier[s]][,filespec[,s]]D The /LIST qualifier generates a listing file of the assembly. /LIST? as a command qualifier prints the assembly listing on the linecD printer and places it in your UFD. If a filespec is not given, theE listing file is assigned the same name as the last source file, withlB .LST file type. /LIST as a filespec qualifier places the file inD your directory but does not pass the file to the line printer. TheB listing file is assigned the same name as the name of the file to which it is attached. ]G /NOLIST is the default and inhibits a listing file from being created.aE All listing-related qualifiers--/[NO]CROSS_REFERENCE, /[NO]WIDE, andaD /[NO]SHOW--imply /LIST. If you use any of them, you do not need toF specify /LIST unless you want to give a listing file a name different' from that of the file in the command. cG See also HELP MACRO WIDE, HELP MACRO CROSS_REFERENCE, HELP MACRO SHOW.t2 NOWIDE#WIDEg2 WIDE6 MACRO/[NO]WIDE filespec[/qualifier[s]][,filespec[,s]]7 MACRO[/qualifier[s]] filespec/[NO]WIDE[,filespec[,s]]i@ The /WIDE qualifier prints the assembly listing in wide format,A sometimes called line-printer format. This is the default. TheS@ /NOWIDE qualifier prints the assembly listing in narrow format,& sometimes called teleprinter format. H This qualifier overrides any .LIST TTM or .NLIST TTM directives in the source code.AE /[NO]WIDE as a command qualifier causes the listing to be printed on[E a printer and placed in your UFD. /[NO]WIDE as a filespec qualifierfD places the file in your directory but does not pass the file to theF line printer. The listing file is assigned the same name as the name' of the file to which it is attached. iE This listing-related qualifier also implies /LIST. If you use this eE qualifier, you do not need to specify /LIST unless you want to give TG a listing file a name different from that of the file in the command. 2 NOOBJECT#OBJECT 2 OBJECT? MACRO/OBJECT[:filespec] filespec[/qualifier[s]][,filespec[,s]] 6 MACRO/NOOBJECT filespec[/qualifier[s]][,filespec[,s]]E The /OBJECT qualifier generates an object file. If a filespec is noteA specified, the object file is assigned the same name as the last: source file, with a .OBJ file type. This is the default. ? The /NOOBJECT qualifier inhibits generation of an object file. 2 DISABLET#ENABLEi2 ENABLE? MACRO/DISABLE:(arg[,s]) filespec[/qualifier[s]][,filespec[,s]]T> MACRO/ENABLE:(arg[,s]) filespec[/qualifier[s]][,filespec[,s]]E The /DISABLE and /ENABLE qualifiers accept arguments which override [F various .DSABL and .ENABL directives specified in the source program.F These qualifiers remain in effect for the entire assembly process. IfF you specify more than one argument, the arguments must be enclosed inB parentheses and separated by commas. You can include /ENABLE and$ /DISABLE on the same command line. O The following arguments (directive equivalent in parentheses) are disabled by p default:e> ABSOLUTE (AMA) BINARY (ABS) LOCAL (LSB) CASEMATCH (LCM)7 TRUNCATION (FPT) CARD_FORMAT (CDR) AUTOMCALL (MCL)dN The following arguments (directive equivalent in parentheses) are enabled by default: : REGISTER_DEFINITIONS (REG) GLOBAL (GBL) LOWERCASE (LC)F See also HELP MACRO SHOW and HELP MACRO WIDE for more information on ! overriding assembler directives. 2 NOSHOW#SHOWn2 SHOWA MACRO/[NO]SHOW:(arg[,s]) filespec[/qualifier[s]][,filespec[,s]] a@ MACRO[/qualifier[s]] filespec/[NO]SHOW:(arg[,s])[,filespec[,s]]C /[NO]SHOW as a command qualifier causes the assembly listing to beUD printed on the line printer and placed in your UFD. /[NO]SHOW as aB filespec qualifier places the file in your directory but does notE pass the file to the line printer. The listing file is assigned theM= same name as the name of the file to which it is attached. tE This listing-related qualifier also implies /LIST. If you use this lE qualifier, you do not need to specify /LIST unless you want to give gG a listing file a name different from that of the file in the command. mC The /SHOW and /NOWSHOW qualifiers accept arguments which override .E various .LIST and .NLIST directives specified in the source program. C These qualifiers remain in effect for the entire assembly process.sF If you specify more than one argument, the arguments must be enclosedC in parentheses and separated by commas. You can include /SHOW and # /NOSHOW on the same command line. eJ The following arguments (directive equivalent in parentheses) are listed by default:D SEQUENCE_NUMBERS (SEQ) LOCATION_COUNTER (LOC) OBJECT_BINARY (BIN)8 EXTENSIONS (BEX) SOURCE (SRC) COMMENTS (COM) 6 DEFINITIONS (MD) CONDITIONALS (CND) CONTENTS (TOC)  CALLS (MC) SYMBOLS (SYM)N The following arguments (directive equivalents in parentheses) are not listed by default:A EXPANSIONS (ME) BINARY (MEB) LISTING_DIRECTIVES (LD) ALLnM See also HELP MACRO ENABLE and HELP MACRO WIDE for information on overridingq other assembler directives.2 USING A MACRO/USING:userassembler filespec[/qualifier[s]][,filespec[,s]]IF The /USING qualifier allows you to invoke an assembler other than theE DIGITAL MACRO-11 Assembler. See your system manager about the avail-S ability of other assemblers.n2 PASS4 MACRO[/qualifier[s]] filespec/PASS:n[,filespec[,s]]G This qualifier assembles your files on either the first or second passn5 of the assembler. The n argument is either 1 or 2. information on overridingq other assembler directives.2 USING A MACRO/USING:userassembler filespec[/qualifier[s]][,filespec[,s]]IF The /USING qualifier allows you to invoke an assembler other than theE DIGITAL MACRO-11 Assembler. See your system manager about the avail-S ability of other assemblers.n2 PASS4 MACRO[/qualifier[  RUN/[NO]POSTMORTEM taskname H The /POSTMORTEM qualifier specifies whether or not a Postmortem Dump is5 to be generated if the task terminates unexpectedly.  TI The default is determined when the task is LINKed. If not specified, theA* LINK command defaults to /NOPOSTMORTEM. ADEF KEY CONT E AS "' '." !LOCATES 2 CONSECUTIVE SPACES )DEF KEY CONT G AS "7ASC." ! Insert bell3DEF KEY CONT L AS "EXT %L." ! BACK TO LAST BUFFER>DEF KEY CONT N AS "EXT C=MAIN.." ! BACK TO ME The File Dump Utility (DMP) allows you to examine the contents of a DD specific file or volume of files. Output can be formatted in ASCII,A octal, decimal, hexadecimal, or Radix-50 form and dumped to any fH suitable output device (printer, terminal, tape, or disk). DMP has two C modes of operation: FILE MODE and DEVICE MODE. File mode is for rG dumping virtual records or virtual blocks; device mode is for dumping ; logical blocks. In file mode, the device must be mounted. 5 In device mode, the device must be mounted foreign. l) The general form of the command line is:i$ outfile/switches = infile/switches f where:i? outfile is the output file specification for the dump. TI: is acceptable.= infile is the name of the file to be dumped, file mode only,w3 or the input device specification, in device mode.  e= For a list of available qualifiers type HELP DMP qualifiers.i 2 QUALIFIERS< Following is a list of legal qualifiers to be used with the File Dump Utility (DMP):, /AS /LC /BA /LIM /BL /LW /BY /MD /DC /OCTe /DENS /RC /FI /RW /HD /R5 /HD:U /SB /HF /SF /HX /SP /ID /WD /LBJ A DMP command line may specify more than one format qualifier. However, J some of the qualifiers are mutually exclusive (see the documentation for E more details). If no qualifiers are specified, /OCT is the default.H , For help on a specific DMP qualifier, type: HELP DMP qualifiernamet2 AS  /AStJ Use the /AS qualifier to dump the data one byte at a time in ASCII mode.D Control characters (0 through 37) are printed as a circumflex (^) F followed by the alphabetic character corresponding to the character  code plus 100.2 BA /BAaE This qualifier specifies a two-word base block address, where n is hC the high-order base block (octal) address and m is the low-order ,F base block address. The format is BA:n:m. You can specify decimal K addresses using a period after the number. This qualifier is useful for mM specifying block numbers that exceed 16 bits. When you use this qualifier 7J in a command line, the result is to set the base address; no blocks are dumped.g2 BL /BL eG Specifies the range of blocks to be dumped, where n is the first and rL m is the last. The format is BL:n:m. Values of n and m cannot exceed 16 L bits. BL is a required qualifier in device mode. You can precede the BL M qualifier with the /HD, /HD:U, or /HF qualifier to specify that the header iI should be dumped with the file (using /BL:0 will dump only the header).o0 /HD dumps the file header in formatted format4 /HD:U dumps the file header in unformatted format- /HF dumps the file header in Files-11 formatb2 BY /BYp? Specifies that the data is to be dumped in octal byte format.n2 DC /DCfA Specifies that the data is to be dumped in decimal word format.v2 DENS /DENSnC This qualifier allows you to specify the density of an input tapesE (where n = 800, 1600, or 6250 bpi) when DMP is in device mode only. K The format is DENS:n. If you do not use this qualifier, DMP attempts to mI read an input tape at the density currently set in the tape controller.l2 FI /FIiI In file mode, the file ID number can be used instead of a file name as G a file specification for input. The format is FI:file-number:seqnum.e2 HD:U#HDc2 HD /HDm /HD:U SD /HD dumps the file header in formatted form. /HD:U dumps the fileG header in unformatted form. Type HELP DMP BL for further informationd2 on using this qualifier in combination with /BL.2 HF /HF,2 Dumps the file header in Files-11 header format.2 HX /HXe> Dumps the data in hexadecimal byte format. Remember that a E hexadecimal dump reads from right to left. (See also /LW and /WD.)i2 ID /ID 9 Causes the version of the DMP utitlity to be displayed. 2 LB /LB L Requests logical block information for a file. DMP displays the starting I block number and a contiguous or noncontiguous indication for the file.u2 LC /LClD Specifies that data should be dumped with lowercase letters where H appropriate, provided that the output device has lowercase capability.2 LIMe /LIMK Limits the range of addresses to dump. The LIM qualifier is overridden : when used with the MD qualifier. The format is LIM:n:m.2 LW /LWeF Specifies that the data should be dumped in hexadecimal double-word format.i2 MD /MDaE Allows control of line numbers in a memory dump. Line numbers are h@ not reset when the block boundary is crossed. The value of n D specifies the value of the first line number. The format is MD:n.2 OCTh /OCTH Specifies that the data should be dumped in octal format in addition ? to other specified formats. The /AS and /OCT qualifiers are l( mutually exclusive when dumping bytes.2 R5 /R5fA Specifes that the data is to be dumped in Radix-50 word format.m2 RC /RC D Dumps that data a record at a time. Data format is controlled by F the /AS, /DC, /HX, /LW, /R5, or /WD qualifiers. The /RC and the /BL$ qualifiers are mutually exclusive.2 RW /RWT1 Rewinds the magnetic tape before reading input.t2 SB /SB:ndG Spaces n blocks forward or backward (use -n) on tape. The format is e SB:n./2 SF /SFsG Spaces n EOF marks forward or backward (use -n) on tape. The format s is SF:n.2 SP /SPu2 Spools the dump output file to the line printer.2 WD /WD ( Dumps data in hexadecimal word format. by F the /AS, /DC, /HX, /LW, /R5, or /WD qualifiers. The /RC and the /BL$ qualifiers are mutually exclusive.2 RW /RWT1 Rewinds the magnetic tape before reading input.t2 SB /SB:ndG Spaces n blocks forward or backward (use -n) on tape. The format is e SB:n./2 SF /SFsG Spaces n EOF marks forward or backward (use -n) on tape. The format s is SF:n.2 SP /SPu2 Spools the dump output file to the line printer.2 WD /WD ( Dumps data in hexadecimal  EXECUTIVE ERROR CODESG The symbols listed below are associated with the directive status B codes returned by the Micro/RSX Executive. They are determinedG (by default) at task-build time. To include these in a MACRO-11O. program, use the following two lines of code: .MCALL DRERR$ DRERR$  ;F ; STANDARD ERROR CODES RETURNED BY DIRECTIVES IN THE DIRECTIVE STATUS ; WORD  ;, IS.CLR +00 Event flag was clear3 IS.SUC +01 Operation complete, SuccessU* IS.SET +02 Event flag was set ; ; ;4 IE.UPN -01. Insufficient dynamic storage4 IE.INS -02. Specified task not installed= IE.UNS -04. Insufficient dynamic storage for sendC& IE.ULN -05. Unassigned LUN2 IE.HWR -06. Device driver not resident+ IE.ACT -07. Task already activeI> IE.ITS -08. Directive inconsistent with task state2 IE.FIX -09. Task already fixed/unfixed7 IE.CKP -10. Issuing task not checkpointablev. IE.TCH -11. Task is checkpointable0 IE.RBS -15. Receive buffer too small+ IE.PRI -16. Privilege violation 7 IE.RSU -17. Specified vector already in use/ IE.NSW -18. No swap space availableE0 IE.ILV -19. Specified vector illegal% IE.ITN -20. Illegal table number  ; ; ;< IE.AST -80. Directive issued/not issued from AST? IE.MAP -81. ISR or enable/disable interrupt routines9 not within 4K words from value ofk/ base address and 177700v2 IE.IOP -83. Window has I/O in progress' IE.ALG -84. Alignment errorc: IE.WOV -85. Address window allocation overflow) IE.NVR -86. Invalid region ID 1 IE.NVW -87. Invalid address window IDt, IE.ITP -88. Invalid TI parameter8 IE.IBS -89. Invalid SEND buffer size (>255.)) IE.LNL -90. LUN locked in uset# IE.IUI -91. Invalid UICh. IE.IDU -92. Invalid device or unit/ IE.ITI -93. Invalid time parameters.6 IE.PNS -94. Partition/region not in system0 IE.IPR -95. Invalid priority (>250.)# IE.ILU -96. Invalid LUNE1 IE.IEF -97. Invalid event flag number87 IE.ADP -98. Part of DPB out of user's space / IE.SDP -99. DIC or DPB size invalidad SEND buffer size (>255.)) IE.LNL -90. LUN locked in usD PMD is the Postmortem Dump task. When a task aborts, PMD generates< a dump of its header and address space to aid in debugging. ,I You can make a task eligible for a Postmortem Dump in any of three ways:D m? o Build the task with the /PM switch on the task image fileD& or DCL LINK/POSTMORTEM commandI o Install the task with the /PMD=YES switch or DCL INSTALL/POSTMORTEMt commandA o Abort the task with the /PMD switch or DCL ABORT/POSTMORTEMs tK Postmortem Dumps are put on the system disk in directory [1,4] in the fileP3 taskname.PMD and are automatically spooled by PMD.  a NOTE, Y4 The print spooler automatically deletes all6 files with the type .PMD after printing them. wK PMD also produces Snapshot Dumps of running tasks. See HELP PMD SNAPSHOT  tL See Appendix D of the RSX-11M/M-PLUS and Micro/RSX Task Builder Manual for  more information on PMD.k t 2 SNAPSHOTL A running task can issue a macro call to generate a dump of its header and # address space to aid in debugging.s mM To generate a Snapshot Dump, you must issue two macro calls in your program. I The SNPBK$ macro must be specified in a data area to define the SnapshoteK Dump Control Block, and the SNAP$ macro must be specified at each place int+ the code where a Snapshot Dump is desired.n 3 SNPBK$ dev,unit,ctl,efn,id,L1,H1,L2,H2,L3,H3,L4,H4n ) SNAP$ ctl,efn,id,L1,H1,L2,H2,L3,H3,L4,H4P T- dev, device and unit efn event flag to usee unit for dump file id number to identify ) ctl what to dump: a particular SNAP$s SC.HDR headert+ SC.LUN LUN table L1,H1 memory limits fore4 SC.OVL overlay segments L2,H2 dumping up to four* SC.STK stack L3,H3 separate blocks of, SC.WRD memory in words/RAD50 L4,H4 memory SC.BYT memory in bytes/ASCII D P Snapshot dumps are put on the specified device under the task's UFD in the file- taskname.PMD, and are automatically spooled.  i NOTEv 5 The print spooler automatically deletes alli7 files with the type .PMD after printing them.C RP See Appendix D of the RSX-11M/M-PLUS and Micro/RSX Task Builder Manual for more information on Snapshot Dumps.S stack L3,H3 separate blocks of, SC.WRD memory in words/RAD50 L4,H4 memory SC.BYT memory in bytes/ASCII D P Snapshot dumps are put on the specified device under the task's UFD in the file- taskname.PMD, and are automatically spooled.  i NOTEv 5 The C RMS-11 is one of two file systems supplied on Micro/RSX systems.1C RMS-11 (Record Management Services for the PDP-11) is a series of L user-callable subroutines that implement sequential, relative, and indexed H file organizations. RMS-11 is accessible from MACRO-11, BASIC-PLUS-2, J COBOL-11, and other DIGITAL languages. Other HELP information available D includes RMS-11 macros, error codes, and utilities. Type one of the7 following commands to access other RMS-11 information:t: HELP RMS ERRORS to obtain RMS-11 error code explanations4 HELP xxx to obtain information on RMS-11 utilities+ where xxx is one of the following:-+ BCK - file back-up CNV - file conversion 2 DES - interactive file design DSP - file display0 IFL - indexed file load RST - file restoration= DEF - file definitioni8 HELP RMS MACROS to obtain a list of RMS-11 macros used by MACRO-11 programmersc; HELP FCS to obtain information on File Control Services,S the alternate file systemx2 MACROSB The following are the user macros defined in the RMSMAC.MLB macro library.  FABDF$f FABOF$ DEF$SZ FAB$B FAB$BT DFIN$G FAB$BT DFIN$L FAB$E F$ALQ number F$BKS number F$BLS number F$BPA number F$BPS number F$CTX numbern F$DEQ number  F$DNA address F$DNS number F$FAC masko F$FNA address F$FNS numberi F$FOP maskM F$FSZ numberd F$LCH number1 F$MRN number F$MRS numbero F$NAM address F$ORG codeo F$RAT masks F$RFM codel F$RTV numbers F$SHR maskS F$XAB address GSA$ address NAMDF$  NAMOF$ DEF$SZ NAM$B NAM$E N$ESA address N$ESS numberF N$RSA address N$RSS numberF* ORG$ fileorg[,] POOL$Bn POOL$EF P$BDB bdbcountB P$BUF bufcountX P$FAB fabcountn P$IDX indexcounte P$RAB rabcount $ P$RABX rabxcount,keysize,keychanges RABDF$  RABOF$ DEF$SZ RAB$B SYN RAB$B ASYN RAB$BT DFIN$G RAB$BT DFIN$L RAB$E R$BKT numberd R$CTX numbers R$FAB address R$KBF address R$KRF numberF R$KSZ number R$LSN numbere R$MBC numberN R$MBF numberN R$RAC numberN R$RBF address R$RHB address R$ROP mask R$RSZ number R$UBF address R$USZ numbera XABDF$] XABOF$ DEF$SZ XAB$B XB$ALLb XAB$B XB$DATb XAB$B XB$KEYB XAB$B XB$PROI XAB$B XB$SUM XAB$BT DFIN$G XAB$BT DFIN$L XAB$E XBAOF$  XBAOF$ DEF$SZ XBDOF$  XBDOF$ DEF$SZ XBKOF$  XBKOF$ DEF$SZ XBPOF$  XBPOF$ DEF$SZ XBSOF$  XBSOF$ DEF$SZ X$AID number X$ALN maskK X$ALQ numberK X$AOP maskR X$BKZ numberR X$DAN numberR X$DEQ numberR X$DFL numberR X$DTP code X$FLG masks X$IAN numbers X$IFL number X$KNM address X$LAN number X$LOC number X$NUL numberF X$NXT address X$POS B X$PRG numberB X$PRJ numberB X$PRO numberB X$REF numberB X$SIZ & $CLOSE fabaddr [,[erraddr][,sucaddr]] $COMPARE input,fld,regZ( $CONNECT rabaddr [,[erraddr][,sucaddr]]' $CREATE fabaddr [,[erraddr][,sucaddr]]m' $DELETE rabaddr [,[erraddr][,sucaddr]]Z+ $DISCONNECT rabaddr [,[erraddr][,sucaddr]]D( $DISPLAY fabaddr [,[erraddr][,sucaddr]]- $ENTER fabaddr [,[erraddr][,sucaddr]]X& $ERASE fabaddr [,[erraddr][,sucaddr]]' $EXTEND fabaddr [,[erraddr][,sucaddr]]b $FBCAL $FETCH dst,fld,regJ% $FIND rabaddr [,[erraddr][,sucaddr]]B& $FLUSH rabaddr [,[erraddr][,sucaddr]]% $FREE rabaddr [,[erraddr][,sucaddr]]R$ $GET rabaddr [,[erraddr][,sucaddr]] $GNCAL[' $NXTVOL rabaddr [,[erraddr][,sucaddr]], $OFF mask,fld,reg% $OPEN fabaddr [,[erraddr][,sucaddr]]C- $PARSE fabaddr [,[erraddr][,sucaddr]]A$ $PUT rabaddr [,[erraddr][,sucaddr]] $RBCALR% $READ rabaddr [,[erraddr][,sucaddr]]S. $REMOVE fabaddr [,[erraddr][,sucaddr]]9 $RENAME oldfabaddr,[erraddr],[sucaddr],newfabaddr $RETURN' $REWIND rabaddr [,[erraddr][,sucaddr]]a $RMSTAT DFIN$Gs $RMSTAT DFIN$Lr. $SEARCH fabaddr [,[erraddr][,sucaddr]] $SET mask,fld,reg $SETGSA pointerd& $SPACE rabaddr [,[erraddr][,sucaddr]] $STORE src,fld,regr $TESTBITS mask,fld,reg) $TRUNCATE rabaddr [,[erraddr][,sucaddr]]]' $UPDATE rabaddr [,[erraddr][,sucaddr]] $WAIT rabaddr& $WRITE rabaddr [,[erraddr][,sucaddr]]2 ERRORS( For a list of RMS-11 error codes, type: HELP RMS ERRORS ALL$ For an individual error code, type: HELP RMS ERRORS xxx5 where xxx is the 3-letter error name or the negative " decimal error value. For example: HELP RMS ERRORS ACC and HELP RMS ERRORS -32 access the same error text.8 For more information, see the RMS-11 Macro Programmer's Guide.,3 ALL]' SU$SUC,000001,1.,5 SU$DUP,000002,2.,]( SU$IDX,000003,3.,' ER$ACC,177740,-32.,2 ER$ACT,177720,-48.,, ER$AID,177700,-64.,+ ER$ALN,177660,-80.,e, ER$ALQ,177640,-96.,3 ER$ANI,177620,-112.,r, ER$AOP,177600,-128.,5 ER$AST,177560,-144.,1/ ER$ATR,177540,-160.,s/ ER$ATW,177520,-176.,3- ER$BKS,177500,-192.,F- ER$BKZ,177460,-208.,t. ER$BOF,177430,-232.,/ ER$BPA,177420,-240.,s- ER$BPS,177400,-256.,e4 ER$BUG,177360,-272.,) ER$CCR,177340,-288.,a0 ER$CHG,177320,-304.,( ER$CHK,177300,-320.,+ ER$CLS,177260,-336.,0, ER$COD,177240,-352.,* ER$CPB,177230,-360.,+ ER$CRE,177220,-368.,$7 ER$CUR,177200,-384.,0- ER$DAN,177140,-416.,40 ER$DEL,177120,-432.,/ ER$DEV,177100,-448.,7+ ER$DFW,177070,-456.,32 ER$DIR,177060,-464.,% ER$DME,177040,-480.,2/ ER$DNA,177030,-488.,-( ER$DNF,177020,-496.,' ER$DNR,177000,-512.,7/ ER$DPE,176770,-520.,0, ER$DTP,176760,-528.,0 ER$DUP,176740,-544.,+ ER$ENT,176720,-560.,A ER$ENV,176700,-576.,5* ER$EOF,176660,-592.,/ ER$ESA,176650,-600.,0- ER$ESL,176644,-604.,<0 ER$ESS,176640,-608.,; ER$EXP,176630,-616.,+ ER$EXT,176620,-624.,r ER$FAB,176600,-640.,2 ER$FAC,176560,-656.,= ER$FAL,176550,-664.,E* ER$FEX,176540,-672.,- ER$FID,177530,-680.,-, ER$FLG,176520,-688.,2 ER$FLK,176500,-704.,/ ER$FNA,176470,-712., + ER$FND,176460,-720.,e% ER$FNF,176440,-736.,X$ ER$FNM,176420,-752.,, ER$FOP,176400,-768.,* ER$FUL,176360,-784.,- ER$IAN,176340,-800.,m, ER$IDX,176320,-816.,- ER$IFI,176300,-832.,D1 ER$IMX,176260,-848.,l1 ER$IOP,176220,-880.,s> ER$IRC,176200,-896.,- ER$ISI,176160,-912.,4/ ER$KBF,176140,-928.,< ER$KEY,176120,-944.,- ER$KRF,176100,-960.,8- ER$KSZ,176060,-976.,<- ER$LAN,176040,-992.,<) ER$LBL,176020,-1008.,., ER$LBY,176000,-1024.,. ER$LCH,175760,-1040.,, ER$LEX,175750,-1048.,6 ER$LIB,175744,-1052.,. ER$LOC,175740,-1056.,= ER$MAP,175720,-1072.,0/ ER$MEM,175710,-1080., , ER$MKD,175700,-1088.,C ER$MRN,175660,-1104.,$. ER$MRS,175640,-1120.,7 ER$NAE,175630,-1128.,00 ER$NAM,175620,-1136.,/ ER$NEF,175600,-1152.,s) ER$NET,175570,-1160.,0. ER$NMF,175554,-1172.,% ER$NOD,175550,-1176.,n7 ER$NPK,175540,-1184., , ER$OPN,175520,-1200.,0 ER$ORD,175500,-1216.,- ER$ORG,175460,-1232.,d3 ER$PLG,175440,-1248.,l? ER$PLV,175430,-1256.,A. ER$POS,175420,-1264.,* ER$PRM,175400,-1280.,+ ER$PRV,175360,-1296.,t ER$RAB,175340,-1312.,6- ER$RAC,175320,-1328.,r- ER$RAT,175300,-1344.,20 ER$RBF,175260,-1360.,, ER$RER,175240,-1376.,- ER$REX,175220,-1392.,2. ER$RFA,175200,-1408.,- ER$RFM,175160,-1424.,t% ER$RLK,175140,-1440.,i, ER$RMV,175120,-1456.,& ER$RNF,175100,-1472.,) ER$RNL,175060,-1488.,d- ER$ROP,175040,-1504.,f, ER$RPL,175020,-1520.,, ER$RRV,175000,-1536.,. ER$RSL,174754,-1556.,. ER$RSS,174750,-1560.,0 ER$RST,174744,-1564.,. ER$RSZ,174740,-1568.,6 ER$RTB,174720,-1584.,2 ER$RVU,174710,-1592.,A ER$SEQ,174700,-1600.,d- ER$SHR,174660,-1616.,d. ER$SIZ,174640,-1632.,< ER$SUP,174610,-1656.,$ ER$SYS,174600,-1664.,# ER$TRE,174560,-1680.,i* ER$TYP,174540,-1696.,0 ER$UBF,174520,-1712.,3 ER$UIN,174510,-1720.,s. ER$USZ,174500,-1728.,/ ER$VER,174460,-1744., 9 ER$WCD,174430,-1768.,d, ER$WER,174420,-1776.,+ ER$WLK,174410,-1784.,,, ER$WPL,174400,-1792.,0 ER$XAB,174360,-1808.,= ER$XTR,174340,-1824.,3 1.#SUC3 SUCB' SU$SUC,000001,1.,-3 2.#DUP3 DUPr5 SU$DUP,000002,2.,S3 3.#IDX3 IDX7( SU$IDX,000003,3.,3 -32.#ACC3 ACCI' ER$ACC,177740,-32.,E3 -48.#ACT3 ACT 2 ER$ACT,177720,-48.,3 -64.#AID3 AID7, ER$AID,177700,-64.,3 -80.#ALN3 ALNe+ ER$ALN,177660,-80.,a3 -96.#ALQ3 ALQe, ER$ALQ,177640,-96.,3 -112.,#ANI3 ANIc3 ER$ANI,177620,-112.,r3 -128.d#AOP3 AOPe, ER$AOP,177600,-128.,3 -144.d#AST3 AST5 ER$AST,177560,-144.,e3 -160. #ATR3 ATR / ER$ATR,177540,-160.,r3 -176. #ATW3 ATW / ER$ATW,177520,-176.,>3 -192.#BKS3 BKS- ER$BKS,177500,-192., 3 -208.Q#BKZ3 BKZ$- ER$BKZ,177460,-208.,23 -232.#BOF3 BOFN. ER$BOF,177430,-232.,3 -240.#BPA3 BPA/ ER$BPA,177420,-240.,13 -256.T#BPS3 BPS$- ER$BPS,177400,-256.,l3 -272.0#BUG3 BUGT4 ER$BUG,177360,-272.,3 -288.#CRR3 CRR) ER$CCR,177340,-288.,t3 -304.1#CHG3 CHG 0 ER$CHG,177320,-304.,3 -320.8#CHK3 CHKK( ER$CHK,177300,-320.,3 -336.#CLS3 CLSF+ ER$CLS,177260,-336.,f3 -352.>#COD3 CODB, ER$COD,177240,-352.,3 -360#CPB3 CPB6* ER$CPB,177230,-360.,3 -368.B#CRE3 CRE + ER$CRE,177220,-368.,r3 -384.S#CUR3 CURd7 ER$CUR,177200,-384.,l3 -416.u#DAN3 DAN1- ER$DAN,177140,-416.,e3 -432.c#DEL3 DEL00 ER$DEL,177120,-432.,3 -448.#DEV3 DEVS/ ER$DEV,177100,-448.,r3 -456.3#DFW3 DFW + ER$DFW,177070,-456.,i3 -464.3#DIR3 DIRP2 ER$DIR,177060,-464.,3 -480.E#DME3 DME$% ER$DME,177040,-480.,r3 -488.S#DNA3 DNAd/ ER$DNA,177030,-488.,c3 -496.#DNF3 DNFN( ER$DNF,177020,-496.,3 -512.e#DNR3 DNRc' ER$DNR,177000,-512.,o3 -520. #DPE3 DPE/ ER$DPE,176770,-520., 3 -528.e#DTP3 DTP, ER$DTP,176760,-528.,3 -544.e#DUP3 DUP0 ER$DUP,176740,-544.,3 -560. #ENT3 ENT>+ ER$ENT,176720,-560.,.3 -576.h#ENV3 ENV4A ER$ENV,176700,-576.,c3 -592.#EOF3 EOFN* ER$EOF,176660,-592.,3 -600.#ESA3 ESA/ ER$ESA,176650,-600., 3 -604. #ESL3 ESL,- ER$ESL,176644,-604.,83 -608.#ESS3 ESST0 ER$ESS,176640,-608.,3 -616.U#EXP3 EXP7; ER$EXP,176630,-616.,>3 -624.,#EXT3 EXT<+ ER$EXT,176620,-624.,43 -640.,#FAB3 FAB< ER$FAB,176600,-640.,3 -656.t#FAC3 FAC2 ER$FAC,176560,-656.,3 -664.6#FAL3 FAL = ER$FAL,176550,-664., 3 -672. #FEX3 FEX,* ER$FEX,176540,-672.,3 -680.S#FID3 FID$- ER$FID,177530,-680., 3 -688.E#FLG3 FLGE, ER$FLG,176520,-688.,3 -740.d#FLK3 FLK2 ER$FLK,176500,-704.,3 -712. #FNA3 FNA/ ER$FNA,176470,-712.,3 -720.A#FND3 FND7+ ER$FND,176460,-720.,63 -736.L#FNF3 FNF$% ER$FNF,176440,-736.,e3 -752.t#FNM3 FNM6$ ER$FNM,176420,-752.,3 -768.a#FOP3 FOP>, ER$FOP,176400,-768.,3 -784.u#FUL3 FULd* ER$FUL,176360,-784.,3 -800. #IAN3 IANi- ER$IAN,176340,-800.,03 -816.l#IDX3 IDXh, ER$IDX,176320,-816.,3 -832.<#IFL3 IFI - ER$IFI,176300,-832.,73 -848..#IMX3 IMX 1 ER$IMX,176260,-848.,-3 -880.e#IOP3 IOP 1 ER$IOP,176220,-880.,i3 -896#IRC3 IRCF> ER$IRC,176200,-896.,3 -912.#ISI3 ISIU- ER$ISI,176160,-912.,3 -928.A#KBF3 KBF7/ ER$KBF,176140,-928.,I3 -944.h#KEY3 KEY3 ER$KEY,176120,-944.,3 -960.<#KRF3 KRF - ER$KRF,176100,-960.,73 -976..#KSZ3 KSZ - ER$KSZ,176060,-976.,y3 -992.8#LAN3 LAN - ER$LAN,176040,-992.,o3 -1008.#LBL3 LBL) ER$LBL,176020,-1008.,d3 -1024.#LBY3 LBYl, ER$LBY,176000,-1024.,3 -1040.#LCH3 LCHe. ER$LCH,175760,-1040.,3 -1048.#LEX3 LEXf, ER$LEX,175750,-1048.,3 -1052.#LIB3 LIB06 ER$LIB,175744,-1052.,3 -1056.#LOC3 LOCZ. ER$LOC,175740,-1056.,3 -1072.#MAP3 MAPN= ER$MAP,175720,-1072.,03 -1080.#MEM3 MEMB/ ER$MEM,175710,-1080.,L3 -1088.#MKD3 MKD0, ER$MKD,175700,-1088.,3 -1104.#MRN3 MRN7C ER$MRN,175660,-1104.,73 -1120.#MRS3 MRSn. ER$MRS,175640,-1120.,3 -1128.#NAE3 NAEr7 ER$NAE,175630,-1128.,03 -1136.#NAM3 NAMO0 ER$NAM,175620,-1136.,3 -1152.#NEF3 NEFl/ ER$NEF,175600,-1152.,E3 -1160.#NET3 NETm) ER$NET,175570,-1160.,K3 -1172.#NMF3 NMF8. ER$NMF,175554,-1172.,3 -1176.#NOD3 NOD,% ER$NOD,175550,-1176.,u3 -1184.#NPK3 NPK7 ER$NPK,175540,-1184., 3 -1200.#OPN3 OPNE, ER$OPN,175520,-1200.,3 -1216.#ORD3 ORDM0 ER$ORD,175500,-1216.,3 -1232.#ORG3 ORGF- ER$ORG,175460,-1232.,d3 -1248.#PLG3 PLGN3 ER$PLG,175440,-1248.,K3 -1256.#PLV3 PLV8? ER$PLV,175430,-1256.,3 -1264.#POS3 POS-. ER$POS,175420,-1264.,3 -1280.#PRM3 PRMN* ER$PRM,175400,-1280.,3 -1296.#PRV3 PRV7+ ER$PRV,175360,-1296.,3 -1312.#RAB3 RAB7 ER$RAB,175340,-1312.,e3 -1328.#RAC3 RAC - ER$RAC,175320,-1328.,e3 -1344.#RAT3 RAT - ER$RAT,175300,-1344., 3 -1360.#RBF3 RBFP0 ER$RBF,175260,-1360.,3 -1376.#RER3 RERd, ER$RER,175240,-1376.,3 -1392.#REX3 REXi- ER$REX,175220,-1392.,23 -1408.#RFA3 RFA>. ER$RFA,175200,-1408.,3 -1424.#RFM3 RFM- ER$RFM,175160,-1424.,B3 -1440.#RLK3 RLKC% ER$RLK,175140,-1440.,s3 -1456.#RMV3 RMV4, ER$RMV,175120,-1456.,3 -1472.#RNF3 RNF1& ER$RNF,175100,-1472.,3 -1488.#RNL3 RNLi) ER$RNL,175060,-1488.,03 -1504.#ROP3 ROP - ER$ROP,175040,-1504.,-3 -1520.#RPL3 RPLx, ER$RPL,175020,-1520.,3 -1536.#RRV3 RRVF, ER$RRV,175000,-1536.,3 -1556.#RSL3 RSLR. ER$RSL,174754,-1556.,3 -1560.#RSS3 RSSd. ER$RSS,174750,-1560.,3 -1564.#RST3 RST>0 ER$RST,174744,-1564.,3 -1568.#RSZ3 RSZ.. ER$RSZ,174740,-1568.,3 -1584.#RTB3 RTBR6 ER$RTB,174720,-1584.,3 -1592.#RVU3 RVUP2 ER$RVU,174710,-1592.,3 -1600.#SEQ3 SEQEA ER$SEQ,174700,-1600.,3 -1616.#SHR3 SHRB- ER$SHR,174660,-1616.,3 -1632.#SIZ3 SIZB. ER$SIZ,174640,-1632.,3 -1656.#SUP3 SUPB< ER$SUP,174610,-1656.,3 -1664.#SYS3 SYS $ ER$SYS,174600,-1664.,3 -1680.#TRE3 TREc# ER$TRE,174560,-1680.,.3 -1696.#TYP3 TYP,* ER$TYP,174540,-1696.,3 -1712.#UBF3 UBF0 ER$UBF,174520,-1712.,3 -1720.#UIN3 UIN13 ER$UIN,174510,-1720.,S3 -1728.#USZ3 USZS. ER$USZ,174500,-1728.,3 -1744.#VER3 VERS/ ER$VER,174460,-1744.,s3 -1768.#WCD3 WCD9 ER$WCD,174430,-1768.,>3 -1776.#WER3 WERc, ER$WER,174420,-1776.,3 -1784.#WLK3 WLKY+ ER$WLK,174410,-1784.,.3 -1792.#WPL3 WPL,, ER$WPL,174400,-1792.,3 -1808.#XAB3 XAB$0 ER$XAB,174360,-1808.,3 -1824.#XTR3 XTR= ER$XTR,174340,-1824.,VERS/ ER$VER,174460,-1744.,s3 -1768.#WCD3 WCD9 ER$WCD,174430,-1768.,>3 -1776.#WER3 WERc, ER$WER,174420,-1776.,3 -1784.#WLK3 WLKY+ ER$WLK,174410,-1784.,.3 -1792. dB RMSCNV reads records from an RMS-11 file of any type and converts@ them into another RMS-11 file of any type. RMSCNV uses standard> RMS-11 file access methods. For initial indexed file loading, use RMSIFL (type HELP IFL). To invoke installed RMSCNV:  CNV [command-string]d To invoke uninstalled RMSCNV: D RUN $RMSCNV tC Type HELP CNV COMMAND for an explanation of RMSCNV's command line.o@ Type HELP CNV SWITCHES for an explanation of RMSCNV's switches. E See the RSX-11M/M-PLUS RMS-11 Utilities manual for more information. 2 COMMANDn o. The general form of RMSCNV's command line is: ) [outfile[/switch...]=]infile[/switch...]e dB outfile - the filespec of the file that is to receive the records= of the input file. wildcards are not allowed. The defaultT7 version for sequential (specified with /AP or /SU), ; indexed, and relative files is the highest version; foro< sequential files without /AP or /SU, the default is theE the highest version + 1. Relative and indexed output filesr/ must exist, unless /CA is specified.RD If outfile is not specified, CNV writes the ouput to TI:.D infile - the filespec of the file from which records will be read. wildcards are not allowed.@ Type HELP CNV SWITCHES for an explanation of RMSCNV's switches. 2 SWITCHES o RMSCNV switches:e) FORMAT DESCRIPTION DEFAULT  o String switches --e i. HELP or ? Print HELP message No help e Global switches -- 1 /AP Append records to sequential No appendx file 3 /BL[:size] Set magtape block size 512. bytesiK /CA[:filespec] Create output file with Output file must exist orwJ attributes of existing file; SEQ file will be created+ if no file is specified,c, use input file attributesK /EO Convert CTRL/Z EOF character Assume null-filled stream?6 to null and pad with nulls to file. physical EOF in stream file7 /[NO]ER Produce exception records /NOERc7 /FO:org Set file organization Sequentiall, /ID Identify current version No id E /IM Process file in block mode Use standard RMS-11 > access modesA /KN:["]keyname["] Read an indexed file using Use primary keye0 key of reference specified 0 by keyname  = /KR:n Read an indexed file using Use primary key (n=0)s) specified key number n3 /LO Honor bucket fill size when Fill bucketsr writing indexed file< /MA Use mass insertion and No mass insertion; random/ sequential PUT operations PUT operations  to optimize performance [C /ML:n Set limit of buffer RMSCNV calculatesk< allocation allocation< /PD[:[#]["]x["]] Pad input records to No record padding output-record length,! if necessary d7 /SL[:filespec] Provide summary listing No summaryl (in file, if specified) n+ /SU Supersede existing No supersede  sequential file d- /TR Truncate input records No truncatei$ to output-record length, if necessary  , /WF Write or read fixed Ignore fixed" control area control area l a where:/- size - a decimal number between 18 and 8192d org - S, sequential file R, relative file I, indexed file x - null7 ASCII A-Z, 0-9, or special character; quotation marksf; required for #, lowercase letter, or space.e7 n - key number (0, 1, 2, ..., maximum defined key)eC Type HELP CNV COMMAND for an explanation of RMSCNV's command line. if necessary  , /WF Write or read fixed Ignore fixed" control area control area l a whe? RMSDES is an interactive utility that allows you to design and A create RMS-11 sequential, relative, and indexed files. To design @ a file, you specify the file's attributes: 1) interactively, by? using the RMSDES SET command, or 2) from an existing, externalnB file, by using the RMSDES GET command, or 3) by using an indirect) command file to execute RMSDES commands.= DES Invokes installed RMSDES for an1 interactive session? DES filename[.ext] [type] Invokes RMSDES and creates a file 3 from an existing fileaA DES @filename[.CMD] Invokes RMSDES by using an indirectt* command file8 RUN $RMSDES Invokes uninstalled RMSDES9 After you have invoked RMSDES, you can type HELP or ? toa obtain additional information.sE See the RSX-11M/M-PLUS RMS-11 Utilities manual for more information. interactive session? DES fil D RMSDSP displays a concise description of any RMS-11 file, includingD container files, that is, RMS-11 files that were backed up to ANSI-C labeled magtape using RMSBCK (type HELP BCK for more information).P To invoke installed RMSDSP: DSP [command-string] To invoke uninstalled RMSDSP: RUN $RMSDSP NC Type HELP DSP COMMAND for an explanation of RMSDSP's command line.@ Type HELP DSP SWITCHES for an explanation of RMSDSP's switches.6 See the RMS-11 Utilities manual for more information. S 2 COMMANDa n. The general form of RMSDSP's command line is: n5 [outfile=]infile[/switch...][,infile[/switch...]...]  A? outfile - the filespec of a file to contain the description ofm> the input file(s). If outfile is not supplied, theA information is displayed on the terminal. No wildcardsP are allowed.n o# infile - the filespec for either:E DB 1. Any RMS-11 file whose attributes you want displayed. ? 2. A backup file on whose contents contents you wantg2 listed. You must use the /BP switch.@ Type HELP DSP SWITCHES for an explanation of RMSDSP's switches. 2 SWITCHES RMSDSP switches:t$ TYPE FORMAT DESCRIPTION DEFAULT l. String HELP or ? Print HELP message No help i, Global /ID Identify current version No id a: /BP List contents of backup Basic display only files(s) D 4 /FU Provide detailed display Basic display only for indexed files or ( for backup filesC Type HELP DSP COMMAND for an explanation of RMSDSP's command line.pe HELP DSP SWITCHES for an explanation of RMSDSP's switches. 2 SWITCHES RMSDSP switches:t$ TYPE FORMAT DESCRIPTION DEFAULT l. String HELP or ? Print HELP message No help i, Global /ID Identify current version No id a: /BP List contents of backup Basic display only files(s) D 4 /FU Provide detailed display Basic display only for indexed files or (  nF RMSIFL reads records from any type of RMS-11 file and loads them intoH an existing, empty, indexed file. RMSCNV also populates indexed files, / but in a nonoptimized fashion (type HELP CNV).k To invoke installed RMSIFL: t RMSIFL [command-string] To invoke uninstalled RMSIFL: RUN $RMSRMSIFL C Type HELP IFL COMMAND for an explanation of RMSIFL's command line. = Type HELP IFL SWITCHES for information on RMSIFL's switches.7E See the RSX-11M/M-PLUS RMS-11 Utilities Manual for more information.  d 2 COMMANDr. The general form of RMSIFL's command line is: ' outfile[/switch...]=infile[/switch...]o p@ outfile - the filespec of an existing, empty, indexed file that; is to receive the records of the input file. wildcardss7 are not allowed. The default version is the highestF9 version. Bucket size must be 5 blocks or less, and no % more than 20 keys can be defined.  D infile - the filespec of the file from which records will be read.> wildcards are not allowed. Any RMS-11 file organization is= permitted but no more than 20 keys can be defined. Do not]? use an RMSBCK output file. RMSIFL ignores the fixed-control ! ares of VFC records.  e= Type HELP IFL SWITCHES for information on RMSIFL's switches.o 2 SWITCHES RMSIFL switches: ) TYPE FORMAT DESCRIPTION DEFAULTb k0 String HELP or ? Print HELP message No help n1 Global /ID Identify current version No idw hA Outfile /ER[:filespec] Write exception records Write exceptioni, to terminal or to records to terminal specified file 7 /NOER[:S] Stop processing if input Write exception e/ record is incompatible records to terminalr 3 /LO Honor bucket fill size Fill bucketsS ' w8 /PD[:[#]x] Pad input records to Handle input as5 output record length exception record ifP different lengths n3 /TR Truncate input records Handle input as0 to output record length exception record if different lengths  Infile /DE:dv1:[dv2:...dv5:]- Reassign devices for sort Create and usep! work files sort work filesn on SY:  i6 /KR:n Key of reference number Primary key (n=0) 5 /NOSO Do not sort before loading Sort input file  before loading  n where:   x - null, pad with nulls9 ASCII A-Z, 0-9, or special character except #, ?, and @/9 octal number 000-377 (40 for SPACE, 43 for #, 77 for ?,u and 100 for @)i r dv - physical device namen s n - decimal numberC Type HELP IFL COMMAND for an explanation of RMSIFL's command line. files sort work filesn on SY:  i6 /KR:n Key of reference number Primary key (n=0) 5 /NOSO Do not sort before loading Sort input file  before loading  n where:   x - null, pad with nulls9 ASCII A-Z, 0-9, or special character except #, ?, and @/9 octal number 000-377 (40 for SPACE, 43 for #, 77 for ?,u and 100 for @)i r dv % LINK/TAS/MAP/SYM/OPTIONS:fspec INPUT  W@ /OPTIONS indicates that you want to use one or more of the TaskE Builder options. LINK prompts you for the options. You may specifyaB one option per line, or you may enter multiple options on a line,C each separated by a comma. When you are through entering options,iE end option input by entering a carriage return on a line by itself. X> /OPTIONS:fspec indicates that you want to specify the options= in the named file. The options should be in a vertical listAA in the file and in the correct syntax for the particular option.n( The file must have a file type of .CMD.@ Here is a list of the options that the Task Builder recognizes.H For information on a particular option, type HELP LINK OPTIONS option. M ABORT - Abort task build LIBR - Task to access system-ownedeI ABSPAT - Absolute patch value for shared resident libraryeK conventional task or I-space MAXBUF - Declares extension to thelG ACTFIL - Number of simultaneously FORTRAN record bufferpK open files ODTV - Declares address and sizesM ASG - Device assignment to of debugging aid SST vectorcI logical units PAR - Partition name and size < CLSTR - Group of shared regions in PRI - Task priorityK same virtual address space RESCOM - Task to access user-ownedoA CMPRT - Completion routine address resident commonAK for supervisor-mode library RESLIB - Task to access user-owned B COMMON - Task to access system-owned resident libraryK shared resident common RESSUP - Task to access user-ownedcD DSPPAT - Absolute patch value for supervisor libraryI D-space or conventional task ROPAR - Partition for read-only K EXTSCT - Extend program section portion of multiuser-taskCE EXTTSK - Extend task memory STACK - Stack size for task N FMTBUF - Extension to buffer that SUPLIB - Task to access system-owned,I processes format strings supervisor-mode libraryd; GBLXCL - Exclude global symbols TASK - Task nameA from .STB file TSKV - Task SST vectoryB GBLDEF - Global symbol definition UIC - User ident. codeE GBLINC - Global symbol inclusion UNITS - Logical units usagemI into .STB file VSECT - Allocates base address,eI GBLPAT - Global relative patch space, and length for asC GBLREF - Global symbol reference virtual P-sectioneF from .STB file VARRAY - Enable virtual arrayK IDENT - Change task .IDENT WNDWS - Number of address windowsy Abbreviation: /OPTo. Default: The Task Builder expects no options.3 ABORTb ABORT=n+ ABORT directs TKB to abort the task build.A Use ABORT when you discover that an earlier error in the commande< sequence will cause TKB to function incorrectly. When TKB : recognizes ABORT, it stops accepting input and restarts a2 new task build to allow you to reenter commands.  n1 Any integer value. TKB ignores it but requires  it for syntax only. 3 ABSPAT. ABSPAT=segmentname:address:val1:val2:...:val8F ABSPAT declares a series of patches starting at the base address thatF you specify. Use this option in either conventional tasks or I-spaceB of I- and D-space tasks. Up to eight patch values can be given. segmentname3 A 1- to 6-character Radix-50 name of the segment.  addressF The octal address of the first patch. The address can be on aF byte boundary; however, TKB always modifies two bytes for each< patch: the byte you address and the following byte. val1...val8F Octal numbers in the range 0 to 177777 that TKB is to store atD the appropriate addresses. TKB stores the value val1 at the@ address you specify; TKB stores val2 at the address you C specify + 2; TKB stores val3 at the adress you specify + 4; F and so forth (the increment is two for each additional value). 3 ACTFIL a ACTFIL=file-max dC ACTFIL declares the maximum number of files that the task can haveeE open simultaneously. TKB allocates approximately 512 bytes for eacha active file. E If a task uses less than four active files (the default), the ACTFILsC option can save space. If the number of active files is more thanT< four, you must use the ACTFIL option to make the additional allocation. h file-maxsE A decimal integer indicating the maximum number of files thati& can be open at the same time.  The default is ACTFIL=4.m3 ASGn/ ASG=devicename:unitnum1:unitnum2:...:unitnum10uA ASG declares the physical device that TKB assigns to one or more  logical units. devicenamea@ A 2-character alphabetic device name followed by a 1- to# 2-digit octal unit number. i unitnum1...5 Octal integers indicating the logical unit numbers.n+ The default is ASG=SY0:1:2:3:4,TI0:5,CL0:6i3 CLSTRe2 CLSTR=library_1,library_2,...library_n:switch:aprB The CLSTR option allows a task to dynamically map memory-resident? shared regions at run time. One task address window maps thea9 libraries into the same span of virtual address space. l: You must follow several rules when designing and building2 shareable clustered libraries. These rules are: E 1. TKB requires all libraries but the default one to be built with i resident overlays.e= 2. If the first library is overlaid and has a null root, ita' should be the first that you call.> 3. TKB resolves all interlibrary references directly through the user task.a: 4. Revectored entry point symbols must not appear in the upstream .STB file.> 5. A called library procedure must not require parameters on the stack.g= 6. All libraries must be PIC or built for the same address.B@ 7. You cannot allow trap or asynchronous entry into a library.A After building the individual libraries and placing the .TSK and ? .STB files for all the libraries into the LB:[1,1] directory,T@ you may build your task. The TKB option line that you must use) for your task has the following syntax: y6 CLSTR=library_1,library_2,...library_n:switch:apr library_nE The first library that you specify is the default library. It isl? the library to which the task maps when the task starts upc> and to which it remaps after any call to another library.@ The total number of libraries to which any task may map is 7 seven, whether or not it uses clustered libraries.TA However, TKB limits the number of the component libraries in> clusters to a maximum of six. For a cluster to exist, itA must contain a minimum of two libraries. Therefore, if yout> use six libraries in clusters, it is possible to have two? clusters of three libraries each, or three clusters of twoa> libraries each, or one cluster of four libraries and one A cluster of two. One cluster of two to six libraries is alsos> possible. If you use six libraries in clusters, the task; may map to only one other, separate, library to make ac? total of seven, the maximum number of libraries possible. s :switch; The switch :RW or :RO indicates whether the cluster isl6 read/only or read-write for this particular task. :aprf? The APR specification is optional and indicates which e> APR that you want TKB to use as the starting APR when TKB? maps to cluster libraries. If you do not specify the APR,.: TKB assigns the highest available APRs and as many as# required to map the libraries.r3 CMPRT CMPRT=namel (RSX-11M-PLUS only)< CMPRT identifies to TKB both the task as a supervisor-mode ? library and the completion routine that the library uses. Thed? library uses the routine to return control to your program ina user mode. 1 Two completion routines are available in SYSLIB:T? 1. $CMPCS restores only the carry bit in the user-mode PS.iD 2. $CMPAL restores all the condition code bits in the user-mode PS. name D A 1- to 6-character Radix-50 name identifying the completion routine.  There is no default.b3 COMMON COMMON=name:access-code[:apr]F COMMON and LIBR are functionally identical to TKB. They both declare? that the task intends to access a system-owned shared region. ? However, by convention, COMMON identifies a shared region thatCF contains data only, and LIBR identifies a shared region that containsB code only. If you specify COMMON with an I- and D-space task, itF causes the common to be mapped with D-space APRs only, and the common it must contain only data. TA System-owned is a definition given to a file that resides in UFDMF [1,1] on device LB: along with its associated symbol definition file.C Therefore, a system-owned common or library is one that resides atr that location.  namenF A 1- to 6-character Radix-50 name that specifies the common orC library. TKB looks for the symbol definition file with the B same name as that of the common or library and with a .STB. extension in UFD [1,1] on device LB:. access-code= The type of access (read/write or read/only) the task F requires. RW indicates read-write and RO indicates read-only. aprF An integer in the range of 1 to 7 that specifies the first APRE that TKB is to reserve for the shared region. TKB recognizess= apr for a mapped system only. You can specify it forbD relocatable regions only. TKB selects the highest availableD APR by default if you do not specify omit APR and the region is relocatable. @ For an absolute shared region, the arguments in the PAR option D determine its base address and the APR that maps it when the region is built. iC In an RSX-11M-PLUS task that uses I- and D-space and a common, TKBtF considers the common as data only. The Executive maps the common withA D-space APRs only. If the same task uses LIBR as an option for aaF region, the Executive maps the library with I-space and D-space APRs.3 DSPPAT, DSPPAT=seg-name:address:val1:val2:...:val8 F DSPPAT declares a series of patches starting at the base address thatD you specify. Use this option in D-space of I- and D-space tasks or; conventional tasks. You can use up to eight patch values. segmentname3 A 1- to 6-character Radix-50 name of the segment.  addressF The octal address of the first patch. The address may be on aF byte boundary; however, TKB always modifies two bytes for each< patch: the byte you address and the following byte. val1...val8C Octal numbers in the range 0 to 177777 that TKb is to storesG at the appropriate addresses. TKB stores the value val1 at the @ address you specify; TKB stores val2 at the address you D specify + 2; TKB stores val3 at the address you specify + 4;B and so forth (the value increasing by 2 for every value).  There is no default.y3 EXTSCT EXTSCT=psectname:extensione6 EXTSCT declares an extension in size for a p-section.@ If the p-section has the attribute CON, the section is extendedC by the number of bytes that you specify. If the p-section has thee= attribute OVR, TKB extends the section only if the length of < the extension is greater than the length of the p-section. psectname. A 1- to 6-character Radix-50 name specifying& the p-section that TKB is to extend. extension5 An octal integer that specifies the number of bytesc% by which TKB extends the p-section.  There is no default.-3 EXTTSK EXTTSK=lengthD EXTTSK declares the amount of additional memory for TKB to allocate@ to the task when the system installs it in a mapped system in aB user-controlled partition. This option extends the D-space of an I- and D-space task.  eB This option could possibly unmap a portion of a library that TKB A linked to an I- and D-space task by extending the task's D-spacen2 too far. See EXTTSK in the Task Builder Manual. B The amount of memory available to the task is the sum of the taskA size plus the increment that you specified in the EXTTSK keyworde/ (rounded up to the nearest 32-word boundary). y lengthl9 A decimal number in the range of 0 to 65,535 specifyingT: the increase in task memory allocation (in words).E TKB extends the task to the size that you specify in the PAR option.3 FMTBUF FMTBUF=maxformattF FMTBUF declares the length of internal working storage allocated forF compiling format specifications at run time. The length of this areaE must be equal to or exceed the number of bytes in the longest format  string to be processed. h maxformatC A decimal integer larger than the default that specifies the A number of characters in the longest format specification. ( The default is FMTBUF=132.t3 GBLDEF GBLDEF=symbolname:value3 GBLDEF declares the definition of a global symbol.U@ TKB considers the symbol definition absolute and the definition6 overrides any definition in the input object modules. symbolnamem: A 1- to 6-character Radix-50 name of the defined symbol. value: An octal number in the range 0 to 177777 assigned to the defined symbol.f There is no default.3 GBLINC/ GBLINC=symbol-name,symbol-name,...,symbol-namet symbol-name7 The symbol that TKB is to include in the .STB file.e There are no defaults.3 GBLPAT7 GBLPAT=seg-name:sym-name[+/-offset]:val1:val2:...:val8a? GBLPAT declares a series of patch values starting at an offsetoF relative to a global symbol. Up to eight patch values can be given. segmentname: A 1- to 6-character Radix-50 name of the segment. symbolname H A 1- to 6-character Radix-50 name specifying the global symbol.  offsetl@ An octal number specifying the offset from the global symbol. val1...val85 Octal numbers in the range 0 to 177777 to be stored at the appropriate addresses.e3 GBLREF/ GBLREF=symbol-name,symbol-name,...,symbol-nameh@ GBLREF declares a global symbol reference, which originates in5 the root segment of the task. Use this keyword for - memory-resident overlays of shared regions. g symbol-name7 A 1- to 6-character name of a global symbol referencei3 GBLXCL/ GBLXCL=symbol-name,symbol-name,....symbol-namef? GBLXCL directs TKB to exclude from the symbol definition fileu3 of a shared region the symbol(s) that you specify.e3 IDENTa IDENT=namee< IDENT changes the task identification from that used in the; MACRO-11 .IDENT statement in the .MAC file to that used in  the IDENT option.C Without the IDENT option, the default is the identification of theaF first .MAC that you encounter. You must supply a name with the IDENT option.3 LIBR LIBR=name:access-code[:apr]F COMMON and LIBR are functionally identical to TKB. They both declare? that the task intends to access a system-owned shared region. u? However, by convention, COMMON identifies a shared region thatnF contains data only, and LIBR identifies a shared region that containsB code only. Using LIBR with an I- and D-space task causes TKB to 9 overmap the library with both I-space and D-space APRs. D System-owned is a definition given to a common or library file thatD resides in UFD [1,1] on device LB: along with its associated symbol definition file.  nameh6 A 1- to 6-character Radix-50 name that specifies the= common or the library. TKB looks for the symbol definitiona> file with the same name as that of the common or the library> and with an .STB extension in UFD [1,1] on device LB:. access-code7 The type of access (read-write or read-only) the taska; requires. RW indicates read-write and RO indicatesa read-only. apr2 An integer in the range of 1 to 7 that specifies5 the first APR that TKB is to reserve for the shared-5 region. TKB recognizes the APR for a mapped systemm3 only. You can specify it for relocatable regionso1 only. TKB selects the highest available APR by 2 default if you do not specify APR and the region is relocatable.B@ For an absolute shared region, the arguments in the PAR option D determine its base address and the APR that maps it when the region is built. dC In an RSX-11M-PLUS task that uses I- and D-space and a COMMON, TKBhF considers the COMMON as data only. The Executive maps the COMMON withA D-space APRs only. If the same task uses LIBR as an option for a F region, the Executive maps the library with I-space and D-space APRs.3 MAXBUF MAXBUF=maxrecordfE MAXBUF declares the maximum record buffer size for any file that thee task uses.uC If the maximum record size exceeds the default buffer length, you m, must use this option to extend the buffer. maxrecord2 A decimal integer, larger than the default, that- specifies the maximum record size in bytes.  The default is MAXBUF=1333 ODTV ODTV=symbolname:vectorlengtha; ODTV declares a global symbol to be the address of the ODThC Synchronous System Trap vector. You must define the global symbol ( in the main root segment of your task. symbolname 7 A 1- to 6-character Radix-50 name of a global symbol. vectorlengthr3 A decimal integer in the range 1 to 32 specifyingu( the length of the SST vector in words.3 PAR  PAR=par-name[:base:length]c9 PAR specifies the partition for which the task is built.AF In a mapped system, you can install your task in any system partitionF or user partition large enough to contain it. In an unmapped system,D your task is bound to physical memory. Therefore, you must installF your task in a partition starting at the same memory address as that* of the partition for which it was built. par-namer The name of the partition. baseo= The octal byte address defining the start of the partition.cE On an unmapped system, you must specify the physical address.a. On a mapped system, the base must be 0 for a, task or a 4K boundary for a shared region. lengthi: The number (octal) of bytes that the partition contains.- In a mapped system, a length of 0 implies ai system-controlled partition.< If the target system is mapped and you specify a partition8 length greater than that of your task, TKB extends your: task's length to match the partition length. This action: is equivalent to using the EXTTSK option to increase task memory.3 If your task's size is greater than the specifiedf< partition size, TKB generates the following error message:, TKB--*DIAG*--TASK HAS ILLEGAL MEMORY LIMITS? If you do not specify the base and length, TKB tries to obtainy= the information from the system on which it is building youra? task. If the partition resides in that system, TKB can obtaink the base and length. E TKB binds the task to the addresses that the partition base defines. E If the partition is user controlled, TKB verifies that the task doess0 not exceed the partition length specification.  The default is PAR=GEN.3 PRIo PRI=priorityT> PRI declares the priority at which the task executes. If youB do not specify a priority when you install the task, TKB uses theB priority in PRI. You cannot run a task at a priority higher than< 50 unless you install it or run it under a privileged UIC. prioritys- A decimal integer in the range of 1 to 250.a The default is PRI=50.t3 RESCOM" RESCOM=filespec/access-code[:apr]@ RESCOM and RESLIB are functionally identical; they both declare> that your task intends to access a user-owned shared region. @ However, by convention, RESCOM identifies a shared region that? contains only data. If you use RESCOM with an I- and D-space I@ task, TKB maps the common with D-space APRs and it must contain only data.r@ The term "user-owned" means that the resident common or library= and the symbol definition file associated with it can resideM@ under any UFD that you choose. You can specify the UFD and the= remaining portions of the filespec for RESCOM. You must not . place comments on the same line with RESCOM. filespeco: The memory image file of the resident common. Chapter 1 discusses the filespec format. access-code3 RW (read/write) or RO (read/only), indicating theu; type of access that the task requires. A privileged : task can change data in or move data into a resident: common even though TKB linked the task to the common with read/only access. a apr7 An integer in the range of 1 through 7 that specifies 8 the first APR that you want TKB to reserve for the3 common. TKB recognizes the APR argument only form/ a mapped system. You can specify it only for7 position-independent shared regions. If you omit thec. APR parameter and the shared region is/ position-independent, TKB selects the highesta" available APR to map the region.4 When a shared region is absolute, the base address6 of the region and the APR that maps it is determined3 by the arguments put into the PAR option when the  region is built. NOTESs6 1. TKB expects to find an .STB file having the same7 name as that of the memory image file, and on the7 same device and under the same UFD as that of thec memory image file.6 2. Regardless of the version number you give in the7 filespec, TKB uses the latest version of the .STBh file.e The defaults are: UFD - current terminal UIC device - SY0:p file type - .TSK file version - latestt3 RESLIB" RESLIB=filespec/access-code[:apr]9 RESLIB and RESCOM are functionally identical; they both h> declare that your task intends to access a user-owned shared = region. However, by convention, RESLIB identifies a shared h> region that contains only code. Using RESLIB with an I- and : D-space task causes TKB to overmap the library with both  I-space and D-space APRs. i@ The term "user-owned" means that the resident common or library= and the symbol definition file associated with it can resideB@ under any UFD that you choose. You can specify the UFD and the= remaining portions of the filespec for RESLIB. You must notd. place comments on the same line with RESLIB. file-spec: The memory image file of the resident common. Chapter 1" discusses filespec format. access-code8 RW (read/write) or RO (read/only), indicating the type' of access that the task requires.e apr7 An integer in the range of 1 through 7 that specifiesi8 the first APR that you want TKB to reserve for the3 common. TKB recognizes the APR argument only forr/ a mapped system. You can specify it only foru7 position-independent shared regions. If you omit the . APR parameter and the shared region is/ position-independent, TKB selects the higheste" available APR to map the region.< When a shared region is absolute, the arguments in the PARC option determine the base address of the region and the APRt. that maps it when the region is built. NOTESK5 1. TKB expects to find a .STB file having the samer7 name as that of the memory image file, and on theo4 same device and under the same UFD as those of the memory image file.6 2. Regardless of the version number you give in the7 filespec, TKB uses the latest version of the .STB. file.s The defaults are the following: UFD - current terminal UIC device - SY0:  file type - .TSK file version - latesth3 RESSUP RESSUP=filespec/[-]SV[:apr]  (for RSX-11M-PLUS only)@ RESSUP declares that your task intends to access a user-owned, @ supervisor-mode library. The term "user-owned" means that the = library and its .STB file can reside under any UFD that you d? choose. You must not place comments on the line with RESSUP. s> When CMPRT and RESSUP appear in a command sequence together,  you must specify CMPRT first. r filespecU: The name of the memory image file of the supervisor-mode library. /[-]SVU/ The code SV for supervisor vectors or -SV forl0 no supervisor vectors. If you specify SV, TKB/ replaces calls to the supervisor-mode librarye: within your task with context switching vectors. If you; specify -SV, TKB directly resolves calls within your tasktA to the supervisor-mode library and you must provide yourP< own means for context switching. The elimination ofC supervisor vectors is useful if the supervisor-mode librarye contains threaded code./ apr/ An integer in the range 0 to 7 that specifies9 the first supervisor APR that TKB is to reserve for thes: library. The default is the lowest available APR. The defaults are the following: UFD - current terminal UIC device - SY0:w filetype - .TSK  fileversion - latest3 ROPARr ROPAR=parname o& (for RSX-11M-PLUS and Micro/RSX only)@ ROPAR specifies the partition into which the read/only portion% of your multiuser TKB is to reside.  parname. The partition name into which the read/write" portion of the task will reside.3 STACKe STACK=stacksizeE STACK declares the maximum size of the stack that the task requires.iD The stack is an area of memory that TKB uses for temporary storage,B subroutine calls, and synchronous trap service linkage. Hardware" register 6 references the stack. stacksize; A decimal integer specifying the number of words that TKB  requires for the stack.  The default is STACK=256.3 SUPLIB SUPLIB=filespec:[-]SV[:apr]  (for RSX-11M-PLUS only)@ SUPLIB declares that your task intends to access a system-ownedF supervisor-mode library. System-owned means that TKB expects to findA the supervisor-mode library and the .STB file associated with itC under UFD [1,1] on LB:. When CMPRT and SUPLIB appear in a commandr2 sequence together, you must specify CMPRT first. filespece2 A 1- to 6-character Radix-50 name specifying the4 system-owned supervisor-mode library. TKB expects9 to find a .STB file having the same name as the libraryo under [1,1] on LB:.o :[-]SVeA The code SV for supervisor vectors or the code -SV for noeE supervisor vectors. If you specify SV, TKB replaces calls to.9 the supervisor-mode library within your task withnD context-switching vectors. If you specify -SV, TKB resolvesF calls within your task to the supervisor-mode library directlyA and you must provide your own mode switching vector. Thes? elimination of vectors is useful if the supervisor-mode ( library contains threaded code.  apr8 An integer in the range 1 through 7 that specifies the1 first supervisor APR that TKB is to reserve fore8 the library. The default is the lowest available APR. There is no default. 3 TASK TASK=tasknameE TASK specifies the name of the task (that is, the name that the task / will have when you install it in the system). tasknamei9 A 1- to 6-character Radix-50 name identifying the task.oB The default task name is the first 6 characters of the task image file name.o3 TSKV TSKV=symbolname:vectorlength @ TSKV declares a global symbol to be the address of the task SSTB vector. Define the global symbol in the main root segment of the task. symbolnameu6 A 1- to 6-character Radix-50 name of a global symbol. vectorlengtht7 A decimal integer in the range 1 to 32 specifying the # length of the SST vector in words.  - There is no default.03 UICd UIC=[g,m]C UIC declares the UIC for the task when you run it as a result of ak time-based schedule request.  g,m7 Octal numbers (group and member) in the range of 1 tot4 377 or decimal numbers in the range of 1 to 255. A+ decimal point must follow decimal numbers.e@ The default UIC is the UIC that TKB is running under (normally the terminal UIC). 3 UNITS  UNITS=maxunits ? UNITS declares the number of logical units that the task uses.w maxunitsT8 A decimal integer in the range 0 to 250 specifying the5 maximum number of logical units. The UNITS keyword9 creates tables that require dynamic memory. Therefore,o- large arguments can exhaust dynamic memory.e The default is units=6.3 VARRAY VARRAY=OVRlD VARRAY specifies an overlaid virtual array such that it may be used. in a way similar to that of a FORTRAN COMMON.D Each segment of an overlaid task that uses the array must define it8 in the same way that you define it in the root segment.; Using VARRAY=CON results in a virtual array subject to ther? restrictions detailed in the Language Reference Manual for theu' particular FORTAN that you are using.  The default is VARRAY=CON.e3 VSECT- VSECT=psectname:base:window[:physicallength]lF VSECT allows you to specify the virtual base address, virtual length,@ and physical memory that TKB allocates to the named p-section. psectname+ A 1- to 6-character program section name.h basey4 An octal value specifying the virtual base address7 of the program section in the range 0 through 177777.r6 This value must be a multiple of 4K if you are using mapping directives.t window 9 An octal value specifying the amount of virtual addressp; space in bytes that TKB allocates to the p-section. Baseo3 plus window must not exceed 177777 (octal).a physicallengtht1 An octal value specifying the minimum amount oft8 physical memory that TKb is to allocate to the section@ in units of 64-byte blocks. TKB rounds this value up to4 the next 256-word limit. This value, when added to6 the task image size and any previous allocation, must: not cause the total to exceed 2048K bytes. If you do not4 specify the value, TKB assumes a value of 0.3 WNDWSa WNDWS=nD WNDWS declares the number of address windows that the task requiresA in addition to those needed to map the task image and any mappedtE array or shared region. The number specified is equal to the number : of simultaneously mapped regions that the task will use.  nC An integer in the range of 1 through 7 on an RSX-11M systemd4 and 1 through 23 on an RSX-11M-PLUS system.  The default is WNDWS=0.u do not4 specify the value, TKB assumes a value of 0.3 WNDWSa WNDWS=nD WNDWS declares the number of address windows that the task requiresA in addition to those needed to map the task image and any mappedtE array or shared region. The number specified is equal to the number : of simultan F The VFY utility checks (verifies) the consistency of Files-11 volume L structure, alters the volume structure, or obtains other information about 6 the volume. The general form of the command line is:  e3 VFY list_file,scratch_device=input_device/switches  oA The input device must be a disk or DECtape mounted as a Files-11nH volume. The list_file defaults to the terminal (TI:), the scratch and input devices default to SY:.  eL For information on the switches available with VFY, type HELP VFY switches.G You may also type the following for addtional help on the VFY utility:l? HELP VFY VFY Describes the default verify functione; HELP VFY PERFORMANCE Suggests performance improvementsl 2 SWITCHES; The available switches for the VFY utility are as follows:t = (no switch) Default function: check validity of the volumel( /DE Restore any marked-for-delete files /DV Validate directoriesf! /FR Display free space on volumen2 /HD Delete bad file headers, prompting for action= /AL Subswitch for /HD - delete all bad headers, no promptn3 /ID Displays the version id number of the VFY taski /LI List all index file0 /LO Scan for lost files and make entry in [1,3] /RC Perform read checkT! /RE Rebuild free storage bit maph /UP Update free storage bit map  o= Additional information on each switch is available by typingR= HELP VFY switchname. You may also type one of the following/ for other help available with the VFY utility:a7 HELP VFY VFY Describes the default VFY function ; HELP VFY PERFORMANCE Suggests performance improvementse o2 DE - VFY list_file,scratch_device=input_device/DEO aC This function resets the marked-for-delete bit in each file's file/F header. The marked-for-delete bit is set when the file system startsG to delete a file, but cannot complete the deletion, usually because of F a system crash. Such a file may either be restored (with VFY /DE) or# deleted with PIP (see main text).  F The input device must be mounted with the system files unlocked using the DCL UNLOCK command.7 Write access to the volume is necessary. It is highlyvH recommended that the volume be mounted private, with only VFY operating on it.  s2 DV h- VFY list_file,scratch_device=input_device/DVh iE VFY validates all the directories on a volume. Each directory entryuF presumably describes a file; VFY /DV attempts to match each directory7 entry with the corresponding header in the index file. A See the main text for information on removing invalid directory i entries.L LB The input device may be write locked. It is recommended that the; volume be mounted private, with only VFY operating on it. n V2 FR i VFY list_file=input_device/FR sD The number of free and used blocks on the disk are listed. PIP /FRB also performs this function, and lists additional data about the  volume. DF The input device may be write-locked. It is not necessary for VFY to% have exclusive access to the volume. 2 AL#HD 2 HD - VFY list_file,scratch_device=input_device/HDT iD VFY scans the system files for validity. When a bad file header is@ encountered, VFY prompts for action. See the main text for the! specific choices at this point. s T= Subswitch /AL supresses the prompt; VFY /HD/AL automatically/ deletes all bad headers.  nA The input device must be mounted with the system files unlocked.v7 Write access to the volume is necessary. It is highlyH recommended that the volume be mounted private, with only VFY operating on it.  d2 ID u VFY /ID < Displays the version identification number of the VFY task. a% No device or list file is specified.c n2 LI e VFY list_file=input_device/LI e0 VFY reports all files listed in the index file. pF The input device may be write-locked. It is not necessary for VFY to% have exclusive access to the volume.s 2 LO o- VFY list_file,scratch_device=input_device/LOy IC VFY locates all files which are not entered in any directory, and n enters them in [1,3]. E Write access to the volume is necessary. It is recommended that the ; volume be mounted private, with only VFY operating on it.  2 PERFORMANCEl _D VFY performance is generally related to ANSI support and task image size.  eF It is necessary to rebuild VFY with ANSI support during SYSGEN part 3F to achieve performance increases for most VFY functions. This is doneG by either rebuilding VFY to with [1,1]ANSLIB.OLB, or by rebuilding VFYd< to link to an FCSRES which was built from [1,1]ANSLIB.OLB.  sH We also recommend that VFY also be either rebuilt, or installed with an? increment, to as large a size as is practical on your system. l _D Once rebuilt with ANSI support, VFY uses the FCS big buffer featureA to read files on the input device several blocks at a time. ThisuD improves performance by reducing the amount of head movement on theF input device. Given ideal conditions, VFY execution time is roughlyG proportional to the inverse of the size of the block buffer within theNH VFY task image. "Ideal conditions" mean large files (true of the indexC file, likely less true of directory files), a responsive operatingr. system, and minimal contention for the disk.  YD Performance of the following VFY functions are not affected by ANSI support and task size:  u /ID, /FR  fH Performance of the following VFY function is affected by task size, but not by ANSI support:V e /RC tH Performance of the following VFY functions are affected by ANSI support and task size:  t- no switch, /DE, /DV, /HD, /LI, /LO, /RE, /UP  u2 RC i/ VFY list_file,scratch_device=input_device/RC:n, rE VFY attempts to read all blocks of all files on the volume. The /RCYG parameter "n" is an optional blocking factor. If it is not specified,sA VFY uses the maximum blocking factor. If the blocking factor isl8 specified, VFY executes the same function, only slower. IF The volume may be write-locked. It is recommended that the volume be1 mounted private, with only VFY operating on it. n w2 RE ,- VFY list_file,scratch_device=input_device/REV lE Alter the free storage bit map in accordance with information in thel; index file. If the default VFY function reports that the "< "Index indicates X blocks free" number is greater than the H "Bitmap indicates X blocks free" number, VFY /RE will alter the bitmap, freeing more blocks.  uA The input device must be mounted with the system files unlocked.e7 Write access to the volume is necessary. It is highly H recommended that the volume be mounted private, with only VFY operating on it.  l2 UP t- VFY list_file,scratch_device=input_device/UPr iE Alter the free storage bit map in accordance with information in the"; index file. If the default VFY function reports that the = "Bitmap indicates X blocks free" number is greater than the tH "Index indicates X blocks free" number, VFY /UP will alter the bitmap,2 allocating blocks which actually belong to files. vA The input device must be mounted with the system files unlocked. 7 Write access to the volume is necessary. It is highly H recommended that the volume be mounted private, with only VFY operating on it.  2 VFYa r* VFY list_file,scratch_device=input_device fH The default VFY function: blocks on a volume are counted two ways. TheE allocation bitmap is a series of bits marked 0 or 1, describing eachuD block on the volume as free or allocated in a file. The index file= contains file headers which describe the blocks contained intD each file. VFY counts blocks each of these two ways, reporting theG counts, as well as noting any blocks allocated to more than one file. y YF The volume may be write-locked. It is recommended that the volume be1 mounted private, with only VFY operating on it. aolume are counted two ways. TheE allocation bitmap is a series of bits marked 0 or 1, describing eachuD block on the volume as free or allocated in a file. The index file= contains file hH The Indirect Command Processor allows CLI command lines to be placed inL an indirect command file. The file is then executed as though the command L lines were entered from a terminal. Indirect also has its own numeric and  string manipulation commands. rJ A summary of commands, special symbols, and functions can be obtained by  typing  a HELP INDIRECT SUMMARY b; Individual command descriptions can be obtained by typing u : HELP INDIRECT commandname -6 Special symbol descriptions can be obtained by typing s HELP INDIRECT symbolnames? NOTE: symbolname does not include the angle brackets.u? Information on the Indirect switches can be obtained by typingn HELP INDIRECT SWITCHES 2 SUMMARYa@ Information about the following Indirect commands is available: d# .ASK .ASKN .ASKS .BEGIN .CHAINn& .CLOSE .DATA .DEC .DELAY .DISABLE .ENABLE .END .ERASE .EXIT b .GOSUB .GOTO .IF .INC .OPEN' .OPENA .OPENR .ONERR .PARSE .PAUSE $ .READ .RETURN .IFDF .IFNDF .IFT. .IFF .IFACT .IFNACT .IFENABLED .IFDISABLED( .IFINS .IFNINS .IFNLOA .IFLOA .SETD" .SETF .SETL .SETN .SETO .SETS+ .SETT .STOP .TEST .TESTDEVICE .TESTFILE% .TESTPARTITION .WAIT .XQT .label M a> Information about the following special symbols is available: $ ACCOUN ALPHAN ALTMOD CLI CONFIG" DATE DEFAUL DIRECT EOF ERRCTL& ERRNUM ERROR ERRSEV ERSEEN ESCAPE EXSTAT EXSTRI FALSE FILERR # FILATR FILSPC FORATT FMASK IASA& LIBUIC LOCAL LOGDEV LOGUIC MAPPED& MEMSIZ NETUIC NETNOD NUMBER OCTAL% PRIVIL RAD50 RSX11D SEVERE SPACE.' STRLEN SUCCES SYDISK SYMTYP SYSDEV % SYSID SYSTEM SYSUIC SYTYP SYUNITC% TICLPP TICWID TISPED TIME TIMOUTQ$ TITYPE TRUE UIC VERSN WARNIN  f* Reserved symbols created by Indirect are: C0 P0, P1, P2, P3, P4, P5, P6, P7, P8, P9, COMMAN C; Other Indirect operations for which help is available are:A E4 SWITCHES SUBSTITUTION of symbols PARAMETER passing. LIBRARY procedures FORMATTING for readability ADVANCED techniques 2 .ASK#ASK2 ASK L Defines or redefines a logical symbol and assigns it a true or false value.  Format: C .ASK [def:tmt] sym txt  CD def - Optional default value to be assigned to the symbol if a line> terminator is typed in response to the question or if a? timeout occurs. The default can be or orf another logical variable. C tmt - Optional decimal timeout count describing the length of timeuE before the default value is used. The format of the parameter9 is the same as that used for the .DELAY directive.i A sym - Logical symbol name consisting of 1 through 6 alphanumericC characters. l7 txt - Text to be displayed on the output display line.r a4 See also HELP INDIRECT ASKN and HELP INDIRECT ASKS.2 .ASKNo#ASKN 2 ASKNJ Defines or redefines a numeric symbol and assigns it an octal or decimal  value.a e Format: ! .ASKN [low:high:def:tmt] sym txtu D low:high - Numeric values that define the range for the response.; The input or default value must be within the range  to be valid.  eF def - Optional default value to be assigned to the symbol if a? line terminator is typed in response to the question or 9 if a timeout occurs. The default can be a numericK, expression or another numeric symbol. lB tmt - Optional decimal timeout count describing the length< of time before the default value is used. The format? of the parameter is the same as that used for the .DELAYr directive.  wH sym - Logical symbol name consisting of 1 through 6 alphanumeric characters. o> txt - Text to be displayed on the output display line.3 See also HELP INDIRECT ASK and HELP INDIRECT ASKS.f t2 .ASKS #ASKSK2 ASKSM Defines or redefines a string symbol and assigns it an ASCII text string up o to 80(10) bytes in length.h  Format: b! .ASKS [low:high:def:tmt] sym txth oD low:high - Numeric values that define the range for the response.> The length of the input or default value must be within the range to be valid.r D def - Optional default value to be assigned to the symbol ifD a line terminator is typed in response to the question; or if a timeout occurs. The default can be a strings+ expression or another string symbol.o tE tmt - Optional decimal timeout count describing the length of < time before the default value is used. The format of< the parameter is the same as that used for the .DELAY directive.h H sym - Logical symbol name consisting of 1 through 6 alphanumeric characters. t> txt - Text to be displayed on the output display line.3 See also HELP INDIRECT ASKN and HELP INDIRECT ASK. 2 .BEGIN#BEGIN2 BEGIN ) Delimits the start of a Begin-End block.t t Format: p .BEGINc lI Note that the .BEGIN command must appear on a line by itself. It cannotlM be part of a .IFx command line. A Begin-End block defines a set of IndirecthK commands that must be entered and exited as a unit. Local symbols definedgI outside the block are accessible, but those created within the block are ; deleted when Indirect exits from the block (reaches .END).D C2 .CHAIN#CHAIN2 CHAINKH The .CHAIN command continues execution from a new command file. UnlikeG the @filename construction, the current file context is not preserved.pG All local symbols are erased (unless the /LO switch is specified) and I execution continues at the first line of the file specified with .CHAIN.a2 .CLOSE#CLOSE2 CLOSEyC Closes a secondary data file. No error is returned if the file is w already closed.  Format: .CLOSE #n f8 where n is the channel number of the file to be closed. K2 .DATAH#DATAm2 DATAA Specifies a single line of data to be output to a secondary filen( previously opened by a .OPEN directive. e Format example: s- .DATA #n This line will go into data file nc eH One or more blanks or tabs can follow the .DATA command. If the first G character is a blank, it is removed and not placed in the output file.NG If the first character is a tab, it is transferred to the output file. L2 .END#END2 ENDiL Delimits the end of a BegiN-End block. All local symbols defined since the0 last .BEGIN command are erased by this command. c Format:  .ENDu N Note that a .END command must appear on a line by itself. It cannot be part  of a .IFx command line. O2 .EXITe#EXIT 2 EXITF Exits from a Begin-End block or a command file, optionally specifyingE exit status. The exit status value can be any 16-bit encoded value. C This value will be available in the next outer command file as the C value of or to the task that spawned Indirect as the exitn status value.  Format: d .EXIT [n]y i7 where n is the numeric expression for the exit status.N o 2 .DISABLE#ENABLEa 2 DISABLEs#ENABLEc 2 .ENABLEr#ENABLE 2 ENABLEI With the .ENABLE and .DISABLE commands, several Indirect operating modesc% can be controlled. These modes are:i t/ Mode Default Scope Default Effectc; ---- ----- ------- ------ settinge -------A oG ATTACH Enabled G Indirect attaches to TI: for comment lines.rF CLI Enabled G Commands not processed by Indirect passed= to default CLI for system. I CONTROL-Z Disabled G CTRL/Z in response to .ASKx exits Indirect.rG DATA Disabled L Input lines are written to an open data file.A DECIMAL Disabled G Numeric symbols are created as OCTAL. I DETACH Enabled G Indirect detaches from TI: for command lines.-E DISPLAY Enabled G Indirect displays the current fields for e .ASKx and "@ ". A ESCAPE Disabled G ESCAPE or ALTMODE is legal for .ASKx  response.G ESCAPE-SEQ Disabled G When Indirect attaches, escape-sequence e" recognition is not enabled.E FULL-DUPLEX Read-only G If enabled, the full-duplex terminal  driver is available.uE GLOBAL Enabled L Symbols of the form $xxxx are placed in ae global symbol table.aM LOCAL Enabled L /LO switch was specified in intial commandr( line.F LOWERCASE Enabled L Indirect is not sensitive to the case of commands or strings. O POTASK Enabled G Parent/offspring tasking support is includede5 in current system.lF QUIET Disabled L Comments and CLI commands are displayed on  the terminal.L SUBSTITUTION Disabled L String substitution is not performed before command line evaluation.cF TIMEOUT Enabled G The timeout parameter of .ASKx commands is processed. B TRACE Disabled G Commands processed by Indirect are not ! displayed on the terminal. D TRUNCATE Disabled G Truncate errors on a .READ command are  not ignored.i u2 .DEC#DEC2 DECT0 Decrement the value of a numeric symbol by one. s Format example: e .DEC J. S2 .DELAY#DELAY2 DELAY @ Delay the execution of an indirect command file for a specifiedH period of time. The argument is a decimal number of time units followedF by the character H, M, S, or T (for hours, minutes, seconds, or ticks respectively).c r Format example: y .DELAY 10S ! Delay 10 secondsi l2 .ERASE#ERASE2 ERASEs .ERASE GLOBAL n r2 Deletes all global symbols from the symbol table. c .ERASE LOCAL  7 Deletes all local symbols defined in the current block  from the symbol table. E .ERASE SYMBOL global-name n< Erases the single symbol global-name from the global symbol table.s d2 .GOTOm#GOTOt2 GOTO Branches to a label.r e Format example: h .GOTO ERRORs .EXIT 1t& .ERROR: ; Warning, error encountered. :2 .GOSUB#GOSUB2 GOSUB1H Saves the location of the next Indirect command and branches to a labelA identifying a subroutine. Upon execution of a .RETURN command, G control returns to the next command line following the .GOSUB command.lG Any parameters to the right of the label and to the left of a comment lJ are transferred to the local symbol COMMAN. The value of COMMAN can then , be parsed to obtain formal call parameters.  Format examples:I t .GOSUB DCBW4 .GOSUB BLDTBL DB,2,176450,210 !Build device table 1J For the second example, the following command line will separate the call parameters: b- .PARSE COMMAN "," DEVICE COUNT CSRADR VECADR c2 .IFr#IFs2 IFJ .IF - Determines whether or not a symbol satisfies A one of several possible conditions.t hH .IFACT/.IFNACT - Determines whether or not a task is active. rK .IFDF/.IFNDF - Determines whether or not a symbol is defined.L ,J .IFINS/.IFNINS - Determines whether or not a task is installed+ in the system.m rJ .IFLOA/.IFNLOA - Determines whether or not a device driver is  loaded.  I .IFT/.IFF - Determines whether a logical symbol is true  or false.e aJ .IFENABLED/.IFDISABLED - Determines whether an Indirect operating mode; is enabled or disabled, or whether an environmentalDB condition is met. Legal options are: 1 CLI, TRACE, CONTROL-Z, GLOBAL, SUBSTITUTION, l3 LOWERCASE, ESCAPE, QUIET, TIMEOUT, FULL-DUPLEX,2 ESCAPE-SEQ, TRUNCATE, POTASK, DISPLAY, ATTACH, DETACH, DECIMAL, LOCAL2 .INC#INC2 INC/0 Increment the value of a numeric symbol by one. y Format example:  .INC Je 2 .LABEL:B#LABEL:S2 LABEL:@ Assigns a name to a line in the command file so that the line  can be referenced. r H Labels that are placed alone on command lines are called Direct Access.L Indirect remembers the exact location of these labels, and they can be used9 to decrease search time for .GOTO and .GOSUB directives.R A2 .ONERR#ONERR2 ONERR,@ Defines a label to branch to upon detecting an error condition.G The scope of the label is limited to the current Begin-End block or to; the currently open command file, whichever is appropriate.  t Format example: h5 .ONERR ERRSRV ! Define the label for a .GOTO ERRSRVa# ! ...operation in case of errorc eK Once an error condition has occurred, another .ONERR label must be defined  to reenable error processing. c2 .OPENr#OPENa2 .OPENA#OPENv2 .OPENR#OPENR2 OPENA#OPEN,2 OPENRs#OPENl2 OPEN .OPEN [#n] filename r; Opens the specified secondary file as an output file.r  .OPENA [#n] filename eE If the indicated file exists, opens it for an append operation.xJ If the file does not exist, a new file is created in the same manner as for .OPEN.  o .OPENR [#n] filenamec iI Opens the indicated file for a read operation by means of the .READr command. M .OPEN, .OPENA, and .OPENR return the FCS-11 status code for the operation in the special symbol .e e2 .PARSE#PARSE2 PARSEf? Strings can be parsed into substrings with the .PARSE command.+ The command line is in the following form:n t: .PARSE ...  = The string is decomposed into substrings as specified by theoG control string. The substrings are stored in the specified variables.p= The first character of the control string delimits the firstEC substring, the second character of the control string delimits thetG second substring, and so on. The last character of the control stringn? is repeated if the number of destination variables exceeds thed length of the control string. tP If there are more variables specified than substrings, the additional variablesH are set to be null strings. If there are fewer variables than parsableJ substrings, the last variable contains the unparsed fragment of .G The symbol contains the actual number of substrings processedh& (including explicit null substrings). s2 .PAUSE#PAUSE2 PAUSE H Stops Indirect from processing to allow user action. Indirect displays> the command line you must enter to resume Indirect operation. h Format: v .PAUSEs2 .READa#READr2 READ> Files can be opened and read by using the following commands: f1 .OPENR [#n] filename Open a file for reading.  i@ .READ [#file] variable Read next record into specified string variable.h c- After a .READ, true if end-of-filen encountered, false if not. 2 Contains the FCS-11 error code if an) error ocurred on the .READ operation.a  e6 For more information, type HELP INDIRECT READ DETAILS 3 DETAILS:ETo read from a data file, the file must first be opened successfully,aCusing the .OPENR command. Records can then be read using the .READ Fcommand until either is set to true or returns an errorDcode. When processing is complete, the file should be closed, usinga .CLOSE command.  nHThe .OPENR command has the same format as the .OPEN and .OPENA commands,Cand also sets the special symbols , , and .  o<The .READ command is similar in format to the .DATA command,Dexcept that instead of having as its argument the text to be writtenDout to a file, the argument is a string variable. The entire record?is written into the string variable. If an error occurs while rBreading a file, the variable is unchanged from its previous state. g;The variable is set by the .READ command. This meansm9specifically that its state is unknown following a .OPENRcAcommand. If an end-of-file has occurred, both and n$are set to indicate the end-of-file. n 2 .RETURNt#RETURNa2 RETURNC Effects an exit from a subroutine and returns to the command line @ immediately following the corresponding .GOSUB subroutine call. v Format: a .RETURN s2 .STOP#STOP 2 STOPJ Immediately stops command file execution, optionally specifying the exit  status for the Indirect task. eJ The .STOP command is synonymous with the logical end-of-file command (/). a Format example: u .STOP 1 O2 .SET#SET2 SET " .SETN variable numeric-expression .SETD variableT .SETO variableE c@ Define or redefine a numeric symbol and assign it a specific< numeric value. The .SETO and .SETD directives change theF default radix of the variable to be octal or decimal respectively. o! .SETS variable string-expressionl pA Defines or redefines a string symbol and assigns the symbol ac* specific ASCII-character string value. l .SETT variablea .SETF variable:" .SETL variable logical-expression ? Define or redefine a logical symbol and assign the symbol ar true or false value.2 .TESTn#TESTs2 TESTD The .TEST command is used to determine the symbol type and return aE type code in . If the symbol is a string, the command testsl1 the length of the string or locates a substring.o  Format examples:r f .TEST ADDRESy6 .IF GT 20. ; Length of response too long rE .TEST ADDRES "STREET" ! Look for the string "STREET" in the string  ! ...contained in ADDRESS.C .IF = 0 .GOTO NOTFND ! = the character position # ! where "STREET" begins.E E If the variable being tested is a string, then the following symbolst5 are set to reflect characteristics about the string:o n% , , , l tM If the variable being tested is numeric and octal, then the following symbol2$ is set to reflect the symbol radix:   @ See also HELP INDIRECT TESTDEVICE, TESTPARTITION, and TESTFILE. 2 .TESTDEVICER #TESTDEVICET 2 TESTDEVICEN Allows a command file to acquire information about any device in the system. H The returned data, including error indication, is found as a string in 3 . The string is in the following format:  i- DB3:,140210,4405,31276,1000,atr,atr,...,atr,l t: See also HELP INDIRECT TEST, TESTPARTITION, and TESTFILE.2 .TESTPARTITION#TESTPARTITION2 TESTPARTITIONaC Allows a command procedure to obtain information about the currentTD partition or any other partition in the system. It can be used to H verify that a partition is of sufficient size before an INSTALL commandH is issued or that it is present before special systems are loaded. The  syntax of the directive is: h .TESTPARTITION partition-name 2H where partition-name is any one- to six-character legal partition name.F If the character "*" is found, then it is assumed the reference is toG the same partition in which this version of Indirect is executing. Ther returned data is in the form: tA partition-name,base in 32-word units,size in 32-word units,type,  s) If the partition is not found, the errori s ,,,NSP, i/ (No such partition) is returned. For example:h  .TESTPARTITION GENi ;'' T might show: o ;GEN,1500,2303,SYS, iJ The partition type is SYS for system-controlled, USR for user-controlled,! or NSP for an unknown partition.t r r7 See also HELP INDIRECT TEST, TESTDEVICE, and TESTFILE.I 2 .TESTFILEu #TESTFILE 2 TESTFILEN Determines if a specific file exists, or performs the translation of assigned- devices. The format of the command line is:   .TESTFILE filespec D The output of the command is contained in the and J special symbols. returns the fully qualified file specificationF and returns the FCS status code from the look-up. (For more@ information on these special symbols, type HELP INDIRECT FILE.) C If no file name is included in the file specification, only deviceD; translation is performed. If a file name is included, theiJ specified file is searched for and the fully qualified file specification is returned in .u f< See also HELP INDIRECT TEST, TESTPARTITION, and TESTDEVICE. s2 FILEF After a .TESTFILE, .OPEN, .OPENA, .OPENR, or .DATA operation, the two4 special symbols and are returned. > is a string symbol that contains the fully qualified file specification. 7 is a decimal numeric symbol that contains thea= status code resulting from the previous operation. The coded will be one of the following:  1. Operation was successful.  uJ negative word Operation failed; code is an operating-system error code. VE postitive word Operation failed; code is a file-system error code.p but negativeo lower bytem sF For example, the error code -1. means "Insufficient dynamic storage,"1 while 230 (-26. as a byte) means "No such file."o ; For a complete listing of all error codes, see the manual. a2 .WAITr#WAITg2 WAITL Waits for a specified task to finish executing or to get exit status from aD previously completed task that was started with the .XQT directive. a Format examples:e r .WAIT PAYROLs. .WAIT ABC ! Wait for the copy of ABC running% ! ...on this terminal to completew2 .XQT#XQT2 XQTpK Initiates a task, passes a command line to it, and then continues indirect. command file processing.f . Format example: t .XQT MAC TEST,TEST=TEST I In this case, use the .WAIT MAC command line to verify that the MAC task  has completed and exited.2 ACCOUNI is a string symbol that contains certain accounting informationvN from the user's accounting block. If accounting is not running, this symbol N returns a series of commas with null entries. The string returned is in the  following format: eG User_name,Session_id,Account_number,CPU,DIR,QIO,TAS,Active_tasks,s gK User_name The first 14. characters of the user name as it appears e= in the system account file followed by the first initialcJ Session_id The three-letter session-ID code followed by the unique login numberI Account_number The user's account number as it appears in the system h account filec- CPU CPU ticks used since logins= DIR Total system directives issued since loginc: QIO Total QIO directives issued since login. TAS Total tasks run since login0 Active_tasks Current count of active tasks l? The individual fields can be isolated with the .PARSE command:e o; .PARSE "," NAME SID ACNT CPU DIR QIO TAS ACT JUNKA uJ Note that since double precision arithmetic is not available in Indirect,G these count values cannot be converted to numeric form and manipulateds in arithemetic expressions. 2 ALPHANK is a logical symbol set to TRUE if last response to a .ASKS querygH was an alphanumeric string; else FALSE. is also set by a .TEST6 command. An empty string also sets to true. b2 ALTMODG is a logical symbol set to TRUE if last question was answeredR' with an ALTMODE or ESCAPE; else FALSE.d2 CLIcA is a string symbol set to MCR, DCL, or another 3- through H 6-character CLI name, depending on the current command line interpreter for the terminal. 2 CONFIGH is a string symbol that contains the build-time parameters and4 values for the current running version of Indirect. y2 DATEH is a string symbol set to the current date. The date is in the  format dd-mmm-yy. m2 DEFAULL is a logical symbol set to TRUE if the answer to the last question6 was defaulted or else a timeout occurred; else FALSE.2 DIRECTK is a string symbol containing a user's current default directory r string; format is [name]. 2 EOFGJ is a logical symbol set to TRUE if the last .READ or .ASKx command 0 resulted in reading past the end of the file.   Format example: s .READ #3 nxtlin .IFT .GOTO END  e2 ERRCTLD is a numeric symbol that controls Indirect processing uponC encountering an error. It is treated as an 8-bit mask with bits 0lE through 7 set to indicate that the user's .ONERR target routine willyH process that class of error. If the bit is clear, Indirect exits after printing the error information. aF The eighth bit (the sign bit or 200 octal) is used to control whetherD Indirect will print any indication of an error. If the bit is set,# no error information is printed.  RE The initial default value for is 1, which implies that onlypL class 1 errors can be handled with a .ONERR address and that error messages will be printed.a tJ You are cautioned about indiscriminate use of this mask because debuggingF a command file becomes very difficult. Refer to HELP INDIRECT ERRORS> for a list of error messages and their assigned class values. rE If you attempt to trap errors other than default class 1, note that tH processing cannot continue in most cases. The error service routine isL limited to a fatal error message and .EXIT. The internal state of Indirect+ is unknown in all but class 1 error cases.g 2 ERRNUMH After processing an error, Indirect places in the error numberJ associated with the error. This value can be used for error-type-specificE processing in an .ONERR routine. See HELP INDIRECT ERRORS for a liste. of error messages and their assigned numbers. e2 SEVERE#ERRORS 2 SUCCESSo#ERRORSa 2 WARNINGu#ERRORS 2 ERRORSH The five symbols below are defined for determining the exit status of a command. Their values are: i = 0l = 1r = 2 = 4r = 17 rK Note that a user or program can encode more than just the low-order 3 bitshH of the exit status. If this is the case, a comparison in the following form will not always succeed: a% .IF = .GOTO CONTINs eJ In this case, the appropriate bits must be masked in order to isolate theI reserved success/fail status field of the exit status. A general form iss u' .IF = &7 .GOTO CONTIN A2 ERRSEVJ After processing an error, Indirect places in the error severityI mask associated with the error. This bit mask corresponds with the bits @ of the mask used to control Indirect error processing. 2 ERSEENA is a logical symbol set to TRUE if any of the followinge conditions are true:p r8 1. < 0 if a negative error code was returned uB 2. (&7) .GT. 1. if an exit status value more severe than was returnedO C 3. is TRUEV A 4. is nonzero  i2 5. If you have specifically used the command line i .SETT . h bK If you use the command line .SETF , the following symbols are alsoi set:r p 1. is set to 0 2. is set to 0 3. is set to  4. is set to 0 r2 ESCAPEK is a logical symbol set to TRUE if the last question was answered)H with an ESCAPE or ALTMODE; else FALSE. is a read-only symbol. e2 EXSTATH is a numeric symbol that contains the exit status value as setN by the last DCL command line, the last .WAIT directive, or the .EXIT command. n warning = 0 = f success = 1 =  error = 2 = R severe error = 4 =  no status = 17 = F E See also . 2 EXSTRIN is a string symbol used to return string results from a more deeply K nested command file to the calling command file or the results of a .TEST-o DEVICE statement.* For an extended example, please refer to: t HELP INDIRECT ADVANCED  I Note that is set to null when Indirect waits for the completion of a task.0 <2 FALSEF is a logical literal symbol used in comparisons with the .IF 2 directive or as a default for the .ASK directive. 2 FILERRE After a .TESTFILE, .OPENx, or .READ statement, contains thesD FCS-11 or directive status code resulting from the operation. These$ codes are documented in the manual. tD For an extended example of code translation to message strings, see HELP INDIRECT ADVANCED. <2 FILATRB The special symbol returns the 7 words of file-attributeD information contained in the FCS-11 File Descriptor Block. The data> is from the FDB used in the last preceding .OPENx operation.  2 FILSPCF The string symbol contains the fully qualified specificationE for the file referred to with the last .OPENx or .TESTFILE directiveeC operation, or in the last specification for a nested command file.o o2 FORATTH is a numeric symbol that contains the octal value of the file K attributes used in opening all data files. This symbol can be reset with cD the .SETN directive to allow foreign-attribute files to be written. u2 FMASKeF is a string symbol that contains the octal value of the threeH system feature mask words, separated by commas to allow easy parsing by the .PARSE directive. T2 IAS #RSX11De2 LIBUICJ is a string symbol set to the directory containing nonprivileged utility tasks; format is [g,m].2 LOCALhC is a logical symbol set to TRUE if the terminal from whichs> Indirect is executing (TI:) is flagged by the terminal driver as a local terminal.e o2 LOGDEVH is a string symbol equal to the device name and unit number of the user's login account. r a2 LOGUIC: is assigned the login UIC for the current user.  t2 MAPPEDH is a logical symbol set to TRUE if the current system supportsH memory management; else FALSE. This symbol is always true on Micro/RSX systems.i 2 MEMSIZD is a numeric symbol assigned the size of memory in K words (1K = 1024.). t2 NETUICI is a string symbol that contains the value of the UIC/DIRECTORYlJ string used on the system volume to hold the DECnet tasks. This symbol isH used with the and symbols to separate and manage the  components of the system.2 NETNODE is a string symbol that contains the name of this system ine a DECnet network. i l2 NUMBERI is a logical symbol used to verify that the last string enterednG in response to a .ASKS directive or tested in the last .TEST directive I contains only numeric characters. An empty string also sets tos TRUE. y2 OCTALmE is a logical symbol set to TRUE if the numeric answer to the A last .ASKN command or the value of the symbol tested in the lastsB .TEST command is octal. If the .TEST command referenced a stringF and only the numeric characters 0 through 7 were found in the string, is set to TRUE.2 PRIVILM is a logical symbol set to TRUE if the current user is privileged. 2 RAD50tB is a logical symbol set to TRUE if the last string testedE or typed in response to a .ASK question contained only characters in ( the Radix-50 character set; else FALSE.2 RSX11DI and are logical symbols set to TRUE if the current system  is RSX-11D or IAS; else FALSE.  i2 SPACEoH is a numeric symbol set to the number of free bytes left in theI symbol table. This value does not include symbol table space that couldt? be gained by a later automatic extension of the Indirect task.a y2 STRLENG is a numeric symbol set by the .TEST command to the length innH bytes of the tested string. Upon initial entry into Indirect, D contains the count of valid parameters passed in the command line.  r2 SYDISKG is a string symbol set to the system disk mnemonic. There is * no associated unit number (see ). t2 SYMTYPA As a result of a .TEST command, contains a numeric codet@ indicating the type of symbol tested. The values returned are: y Logical = 0 Numeric = 2 String = 4 2 SYSDEVG is a string symbol that contains the name of the system disk.e y2 SYSIDiE is a string symbol that contains the 1- through 6-character o# operating system baselevel number.  a2 SYSTEML is a numeric symbol set with the value 6 to indicate the operating system is Micro/RSX.Y P2 SYSUICE is a string symbol set to the current system UIC; format is  [g,m].o y2 SYTYPeH contains a string consisting of up to 12 ASCII characters that 0 identifies the system (for example, Micro/RSX).2 SYUNITJ is a numeric symbol set to the unit number of the system device. See . u2 TIMEG